PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G074300.3
Common NamePOPTR_0004s07270g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 486aa    MW: 53577.8 Da    PI: 6.5224
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G074300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1658102147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Potri.004G074300.3  58 RERWTEEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 102
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1652106IPR009057Homeodomain-like
PROSITE profilePS5129421.47653107IPR017930Myb domain
TIGRFAMsTIGR015575.7E-1756105IPR006447Myb domain, plants
SMARTSM007172.5E-1357105IPR001005SANT/Myb domain
PfamPF002495.7E-1458101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-95898IPR009057Homeodomain-like
CDDcd001672.32E-1060103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MAIQCGGTRL NLVLPAGNGI SLSAPLNNAS GQQLKEQFSC GSDYSPKARK PYTITKQRER  60
WTEEEHKKFL EALKLYGRAW RRIEEHVGTK TAVQIRSHAQ KFFSKVVRES GGSNTSSVEP  120
IEIPPPRPKR KPMHPYPRKL AHPLEKELLI PEKSLRSSSP NFSISEQENQ SPTSVLSAVG  180
SDALGSTDSD TPNHSLSPVS FAGGVHHADS SPEEDGSPSP ATASSVPDEQ FPKVEKLDSS  240
PEENVSSDEP VVEETSTRSL KLFGRTVLVT EWHKPSSPNM GTSKLSTPDA AEEKLVRPLT  300
LNNVAAEFPF RNGESTWSPL PHGSHGALCY KKFQKENSSP AQNDSAPLPW WTLYGAMPFP  360
CIPFHKKEPA IENLDSKGDE VQDKEIPKEV SWTGSNSGLV SEGENVDKNM DAETESQQFS  420
YEEKELSPIF ELKLTRKSAS SGSKVINEKC PKGFVPYKKR IAERDSQSST ITGEEREEQR  480
IRLCL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.3500.0bud| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G074300.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455555.10.0protein REVEILLE 1 isoform X2
TrEMBLA0A2K2AR850.0A0A2K2AR85_POPTR; Uncharacterized protein
STRINGPOPTR_0004s07270.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-67MYB_related family protein