PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G057900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 382aa    MW: 43374 Da    PI: 9.7116
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G057900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-3172125255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+ekAtPk +l+lm+v gL+++hvkSHLQ+YR+
  Potri.004G057900.1  72 PRLRWTPDLHLSFVHAVERLGGQEKATPKLVLQLMNVRGLSIAHVKSHLQMYRS 125
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.62868128IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-3068126IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1470126IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-2372127IPR006447Myb domain, plants
PfamPF002499.4E-973124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGGCEDQADN TSLMSSFDLN EEASSGEDIG TVEVSNSDAE KITEENYANN ASSAERNERK  60
STVRQYVRSK MPRLRWTPDL HLSFVHAVER LGGQEKATPK LVLQLMNVRG LSIAHVKSHL  120
QMYRSKKLDE AGQVLCQTYR SMQGRGYIPS KFHQMPANPQ QCFRMESGGI VLARNSTEHT  180
FGNSLLHSSL FQRPLSNKTS FSRCQEWGVD KHRVSSLARK DLGQGLDTST TEIRPMRPVR  240
FLEERRWPPL EMVKNRWKII RNNPTSVTCA HSCSPPQAHQ NCSSPRSFET TCYWKPNGGN  300
SGNDIKIKQS LFNSSLSIGN FNSFKPEFDP PFRVELNHDK LLKDKEWLPD LQLRMNQRVG  360
IKDRKTHCRS TQEISTKLSL S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G057900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455564.10.0uncharacterized protein LOC7470204
TrEMBLA0A2K2AQG00.0A0A2K2AQG0_POPTR; Uncharacterized protein
STRINGPOPTR_0004s05660.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-39G2-like family protein