PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G051600.1
Common NamePOPTR_0004s05090g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 391aa    MW: 43080.4 Da    PI: 9.2161
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G051600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox542.9e-1757117257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         ++R++++++q+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Potri.004G051600.1  57 KPRWNPKPDQIRILEAIFNSgMVNPPRDEIRKIRVQLqeygQVGDANVFYWFQNRKSRSKH 117
                         89*****************99*************************************995 PP

2Wus_type_Homeobox109.32.3e-3556118264
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         +++RW+P+p+Qi+iLe++++sG+++P+++ei++i+ +L+eyG+++d+NVfyWFQNrk+R++++
  Potri.004G051600.1  56 PKPRWNPKPDQIRILEAIFNSGMVNPPRDEIRKIRVQLQEYGQVGDANVFYWFQNRKSRSKHR 118
                         689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1251121IPR009057Homeodomain-like
PROSITE profilePS5007110.18753118IPR001356Homeobox domain
SMARTSM003897.5E-855122IPR001356Homeobox domain
CDDcd000862.16E-756118No hitNo description
Gene3DG3DSA:1.10.10.601.1E-656125IPR009057Homeodomain-like
PfamPF000468.5E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MASSNKHWPS MFKSKPCNPH DHQWQHDINP SSIISTGCHR TPYTSVPGCD ERSPEPKPRW  60
NPKPDQIRIL EAIFNSGMVN PPRDEIRKIR VQLQEYGQVG DANVFYWFQN RKSRSKHRLR  120
NLQNSKQHSS QQQKITSPTT KPVTANLAAP SSSSSSSEKS SPKGSKRTLS LSSPTFIDAS  180
NSPTSSVNKT YFQAHNEFVP EPFFFHSQQT GGGGTGAFAQ GFCFSELSNM VHVQDHTVGP  240
CSRLLLSEIM NSSASKKVNH EERNLKMQPQ LCYTPVSPVT GSIGLAPPLT PSTDTSTFAF  300
QTTINQIQGL GQSSGTTMLT VFINDVAFEV TMGPFNVREA FGDDVLLIQS SGQPVLTNEC  360
GVTLQSLQHG AFYYLVPFSM SEHILKKNGK *
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First detected in the basal daughter cell of the zygote (PubMed:14711878). Unlike WOX2 and WOX8, it is not expressed in the egg cell or the zygote (PubMed:14711878). During two subsequent rounds of transverse cell divisions, it is restricted to the hypophysis (PubMed:14711878). At the 8-cell stage, it expands into the central domain of the embryo, in addition to weakening in the hypophysis (PubMed:14711878). After protoderm formation, expression in the central embryo domain is restricted to the protodermal cells and also disappears from the hypophyseal cell (PubMed:14711878). In subsequent stages, a ring of expression remains at the presumptive boundary between root and hypocotyl, at about the same position as WOX2 expression in heart stage embryos (PubMed:14711878). In addition to its embryonic expression, it is expressed postembryonically in the epidermal cells of the placenta during gynoecium development, but not in the developing ovules (PubMed:14711878). The placental expression disappears soon after fertilization (PubMed:14711878). Expression dynamics require MP and BDL, but not GN activity (PubMed:14711878). Detected as early as the first zygotic division in both the apical and the basal daughter cells (PubMed:17706632). By late globular to early transition stage, the protein is evenly distributed through out the embryo and the suspensor (PubMed:17706632). The basal half of the embryo, especially cells in the protoderm layer, starts to show slightly higher levels of expression by early heart stage (PubMed:17706632). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:17706632}.
UniprotTISSUE SPECIFICITY: Expressed in the basal cell and later at the boundary between suspensor and proembryo (PubMed:14711878). Expressed at low levels in proliferating tissues post embryonically (PubMed:15753038). Detected in vegetative shoot apical meristem, leaf primordia, floral meristems, emerging floral organs, epidermal layer of the placenta and in the upper portion of the root meristematic zone (PubMed:15753038, PubMed:20110319). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:20110319}.
Functional Description ? help Back to Top
Source Description
UniProtHomeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G051600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827080.0KF982708.1 Populus tomentosa WOX9a (WOX9a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454266.10.0WUSCHEL-related homeobox 9
SwissprotQ6X7J45e-90WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A3N7EW690.0A0A3N7EW69_POPTR; Uncharacterized protein
STRINGPOPTR_0004s05090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Representative plantOGRP61031220
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.18e-62homeobox-3
Publications ? help Back to Top
  1. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  3. Raines T, et al.
    The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
    Plant J., 2016. 85(1): p. 134-47
    [PMID:26662515]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]