PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G048700.1
Common NamePOPTR_0004s04840g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1730aa    MW: 195763 Da    PI: 5.4566
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G048700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-192782257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         kR+  t+ qle+Le++++ + yps+e+r+eL++klgL++rq ++WF+ rR k+kk
  Potri.004G048700.1 27 PKRQMKTPFQLETLEKAYATETYPSEEMRAELSEKLGLSDRQLQMWFCHRRLKDKK 82
                        69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-18583IPR009057Homeodomain-like
SuperFamilySSF466894.15E-171683IPR009057Homeodomain-like
PROSITE profilePS5007117.2482383IPR001356Homeobox domain
SMARTSM003893.0E-192587IPR001356Homeobox domain
PfamPF000464.7E-172782IPR001356Homeobox domain
CDDcd000861.64E-142883No hitNo description
PROSITE profilePS5082716.75513572IPR018501DDT domain
SMARTSM005713.2E-22513572IPR018501DDT domain
PfamPF027911.2E-17514569IPR018501DDT domain
PfamPF050667.0E-6697754IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.1E-7894938IPR028942WHIM1 domain
PfamPF156132.1E-1310771149IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1730 aa     Download sequence    Send to blast
MEANSDEEQQ NRSKNNVVSS NEGQSKPKRQ MKTPFQLETL EKAYATETYP SEEMRAELSE  60
KLGLSDRQLQ MWFCHRRLKD KKETPVKKQR NTAPLPESPL EDMRIGAENG SDYGSGSGSG  120
SSPLSESRKV ILDDGHTMRR YYDSSPQSVM ELRAIACVEA QLGEPLREDG PILGMEFDPL  180
PPDAFGTPIA SITEQQKRMG YSYEDKVYER HDAKSSKDHA SVRSDAYGLT QSPYHDSPVD  240
TLRGRASPFG AGQISRARLM SQQDKRGHVF SSPQRDDDYL LQRDTFANNR TSAQSNSHPI  300
MGPENPNVFS DAQTFHHDTE LRLERKRKIE EPRTVRDVEA CENRMRKELE KQDILRRKNE  360
ERMRKEMERH DRERRKEEER LMRERQREEE RLLREQKREL ERREKFMQKE YLRAEKRRQK  420
EELRREKEAV KRKAAMEKAT ARKIAKDSLD LIEDEQLELM ELAAASKGLA SIVNLNYDTL  480
QNLDSFRDLL ITFPSESVQL KKPFGFQPWL DSEENIGNLL MVWRFFITFA DVLGLWPFTL  540
DEFVQAFHDY DSRLLSELHV ALLKLIIKDI EDVARTPSIG LGINQYYTAN PEGGHPQIVQ  600
GAYTWGFDIR NWQQHLNPLT WPEILRQLAL SAGFGPQLRK RNATWTGLGD IDEMQVKDCE  660
DIISTIRNGS AAENAFALMR EKGLLLPRKS RHRLTPGTVK FAAFHVLSLE GSKGLTVLEL  720
ADKIQTPEAS ISVALTRDQK LFERIAPSTY CVRAAFRKDP ADAEAILAAA RKKIRIFENG  780
FLGGEVADDV ERDEESEGDV DEDPEVDDLA TPLSANKSTV PSSKLNTLSV SGKYKVGNDI  840
SLTVQNESEK GLSTFSLNGP KDVMTPIIIE QCVTHKDEGT NNGDGQNIEI DESKSGESWI  900
QGLTEGEYSH LSVEERLNAL VVLVGIANEG NSIRSVLEDR LEAANALKKQ MWAEAQLDRS  960
RLKEEFISKL DFPSLTGGRV ETQVASSALE GSQSPLVLVD SKNKEASPSN AEDQKSLAEN  1020
VENHLSSVLS EKALVVQDLS MNPDNISVQQ HGYASKRSRS QLKAYVTHLA EELYIYRSLP  1080
LGQDRRRNRY WQFVASASRN DPCSGRIFVE LHDGNWRVID SEEAFDTLLS SLDTRGVRES  1140
HLRIMLQKIE SSFKENGRRN LWSPNIVCQS GTTDENKKAE TDSGNCPADI DDPSSMFCVS  1200
SSDTFDTFSL FRIELGRNSA EKKGALKRYL DFQNWMWKDC FNSSTLRAMK FGKKRCEQLL  1260
DTCNLCFSSY LSEDTHCLSC HQTFKVDKKN FDFAEHEIQC KEKRFDPGNA RAFDSCLPLG  1320
IRLLTALLGS IEVSVPQEAL ESFWMEICRK DWVVKLIMSS STEELLQRLT VFESAIKRER  1380
LSSNFETTKE LLGPSASSGS AARDSASLGS VSLLPWMPKT IAAVALRLFE LDASIIYVKN  1440
EKPEPSTDKS VKVYMKLPSR YSDFKNEEVE IKDVKLEEHN KEEIVDLRGK RSNYKRGRGG  1500
RDQGLATKWQ RRVPGLKSDT GRQSSSRGIQ NLNQGPRQQG RKTNLQASSR GRRTVRKRRV  1560
EKTVAKEPLL GRMRRVEKTV AKEPLLGRMT NTVAAPVSYL SKKTAARNSY VKSFRNLDDE  1620
DWSAKKGSLN VVGDDNSNSM EEAESDDDVE EEVYEQGNWE PGFNGTSNGW NRNSMEVSDD  1680
DGDASNGIAA MGDDDSEGDI EMSDGSDREA NRVKNDEGLD YADSDEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17582RRLKDKKE
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G048700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455752.10.0homeobox-DDT domain protein RLT1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2K1YG450.0A0A2K1YG45_POPTR; Uncharacterized protein
STRINGPOPTR_0004s04840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Representative plantOGRP15771634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1