PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G046600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 392aa    MW: 43138.1 Da    PI: 8.7628
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G046600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-393594261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  Potri.004G046600.1 35 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRV 94
                        7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-333793IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-273893IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5253993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MVQNQIDEKS LMESTGKLME RPSEEVLSQP QQQQQQQALK CPRCDSSNTK FCYYNNYSLS  60
QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRVRRPASA VEGANNSVSS ANPNPQTPID  120
HISPTSNHIN PLFYGLTSSN PSEMDLPFPG RFNSRVYSAV SGYHDLQPQL NALALGFSSG  180
IMSANDANGF NPTKQIQDVV TSNSLLSSYS NLFGSSTTST NTTSPTMASL LASSFNQQKS  240
TRAPNLYQNL TVPFEDLQMS GNSESGVGMK GVKIEHDQNR SNWNVPCQNQ IEQVGFSDPS  300
MYWNTTNSVG SWHDPANMGG VYGTQIGDGL RLSLNKGIRL VWLEPKDERS LDQRDHVSCK  360
ISLLVLFSRL RNPICTERNL GSSSLSSTQL S*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G046600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647380.0KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454290.10.0dof zinc finger protein DOF1.4
TrEMBLA0A2K2APX00.0A0A2K2APX0_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-178(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-37Dof family protein