PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G046100.1
Common NamePOPTR_0004s04590g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 326aa    MW: 35553 Da    PI: 9.2047
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G046100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.41.3e-372888262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++ +kcprC+s ntkfCyynnyslsqPryfCk+C+ryWt GG++rnvPvGgg+rk k+++
  Potri.004G046100.1 28 QQQPQKCPRCESLNTKFCYYNNYSLSQPRYFCKTCKRYWTLGGTMRNVPVGGGCRKGKRAK 88
                        57899***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252886IPR003851Zinc finger, Dof-type
PfamPF027015.2E-323086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1183286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MQRKMQGGSE DVKPNQERRL KSTQGDDQQQ PQKCPRCESL NTKFCYYNNY SLSQPRYFCK  60
TCKRYWTLGG TMRNVPVGGG CRKGKRAKTS SSSSGENSRL QQQLQQQSQL LQHNLATPQN  120
ILATTNSGNS VSPALRTKES GNLVSPPTPG MSSMGSYFPG DGFLTSLEAI QSLNNNQPPI  180
QSFSFQPLNQ PVNLGGDLGD TSNLGLLHGF SAVPAFGSQN QQQRQFYHVD NRGNKSVEHS  240
FYPHDQESLI QSSRPAATSS HQQQNWHQGF ISNSNPTVSD AVLWSISTST TIGHPNSNIN  300
TGTAGSASLN PDQWHHDLPG NGPPS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G046100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305784.10.0dof zinc finger protein DOF1.4
TrEMBLB9H2S70.0B9H2S7_POPTR; Uncharacterized protein
STRINGPOPTR_0004s04590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.19e-33OBF binding protein 4