PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G038800.1
Common NamePOPTR_0004s03900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 305aa    MW: 33910.7 Da    PI: 8.5526
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G038800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.74e-3644101360
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         +++lkcprC+stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++ 
  Potri.004G038800.1  44 SESLKCPRCESTNTKFCYYNNYNKSQPRHFCKTCKRHWTKGGTLRNVPVGGGRKNKRP 101
                         5789***********************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2245100IPR003851Zinc finger, Dof-type
PfamPF027012.6E-314699IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.47547101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGLSSKQVTS NGLDWSQTLL QERTLELPKP PAIRRQQQQN QLQSESLKCP RCESTNTKFC  60
YYNNYNKSQP RHFCKTCKRH WTKGGTLRNV PVGGGRKNKR PKTSKTNADT TTSTNTASTA  120
APRTDNSNNM INRVNPQQPI QAQQQKQNLP DLVLGDQKNL SGILYQAMIN PPSSVLQQNS  180
ISCNNLDTKS FNTNNNGVLL GSSLSLPQIQ GSLFPCPSSF DTHPSLICTS SFQPLNVYNY  240
SGESMEDSTI TTIMPSTSST IAQPWQVPNT SSGMDMTNYW NWDDIENYVS TDLNVTWDDS  300
EIKP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G038800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305681.10.0dof zinc finger protein 4
TrEMBLB9H2630.0B9H263_POPTR; Uncharacterized protein
STRINGPOPTR_0004s03900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-28DOF zinc finger protein 1