PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G020400.1
Common NamePOPTR_0004s01980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 726aa    MW: 79870.5 Da    PI: 5.5615
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G020400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1958113156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++ +e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.004G020400.1  58 KKRYHRHTQRQIQDMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 113
                         688999***********************************************998 PP

2START212.91.2e-662474661206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         e+a +a++el++ a+a+ep+W +     e++n++e+l++f+++ +      ++ea+r+s+vv+m++++lve+l+d + qW++ +     +a
  Potri.004G020400.1 247 EIAVAAMEELMRIAQAGEPLWIQGEnntEMLNEEEYLRTFTRGIGpkplgMRSEASRESAVVIMNHVNLVEILMDAN-QWSTIFCgivsRA 336
                         57899*************************************999********************************.******99999** PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tlev+s+g      galq+m+ae+q++sp+vp R+ +fvRy++q+++g+w++vdvS+ds ++      + +++++pSg+li++++ng+sk
  Potri.004G020400.1 337 MTLEVLSTGvagnynGALQVMTAEFQVPSPIVPtRENYFVRYCKQHTDGTWAVVDVSLDSLRPSL----LSKCRRRPSGCLIQELPNGYSK 423
                         **************************************************************965....688899**************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+wveh+++++r++++++r+lv+sgla+gak+wv tl+rqce+
  Potri.004G020400.1 424 VVWVEHIEVDDRSVQNIYRPLVNSGLAFGAKRWVGTLDRQCER 466
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-2239113IPR009057Homeodomain-like
SuperFamilySSF466893.55E-1842115IPR009057Homeodomain-like
PROSITE profilePS5007116.43955115IPR001356Homeobox domain
SMARTSM003891.2E-1756119IPR001356Homeobox domain
CDDcd000861.41E-1758116No hitNo description
PfamPF000464.9E-1758113IPR001356Homeobox domain
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
SuperFamilySSF559611.51E-33238468No hitNo description
PROSITE profilePS5084844.721238469IPR002913START domain
CDDcd088751.20E-123242465No hitNo description
PfamPF018525.3E-56247466IPR002913START domain
SMARTSM002341.0E-66247466IPR002913START domain
Gene3DG3DSA:3.30.530.202.7E-4346465IPR023393START-like domain
SuperFamilySSF559614.4E-25487717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MFQANMFEGH HMFDMASKSS ENDSSKLKDD DYETKSGTET MEAQSGDDQD PSEQHPKKKR  60
YHRHTQRQIQ DMEAFFKECP HPDDKQRKEL SRELGLEPLQ VKFWFQNKRT QMKAQHERSE  120
NSILKAENER LRVENNRYKE ALRNASCPNC GGPAALGEMS FDEQHLRIEN VRLREEIDRI  180
SGIAAKYVGK PLSSLSNLSP HLPSRSLDLG VSNFGAQSGF VGEMFGATDL LRSVTGPTEA  240
DKSMIVEIAV AAMEELMRIA QAGEPLWIQG ENNTEMLNEE EYLRTFTRGI GPKPLGMRSE  300
ASRESAVVIM NHVNLVEILM DANQWSTIFC GIVSRAMTLE VLSTGVAGNY NGALQVMTAE  360
FQVPSPIVPT RENYFVRYCK QHTDGTWAVV DVSLDSLRPS LLSKCRRRPS GCLIQELPNG  420
YSKVVWVEHI EVDDRSVQNI YRPLVNSGLA FGAKRWVGTL DRQCERLASS MAINIPSGDL  480
CVITTAEGRK SMLKLAERMV MSFCTGVGAS TAHAWTTLSA TGSDDVRVMT RKSMDDPGRP  540
PGIVLSAATS FWIPVQSKRM FDFLRDENHR SEWDILSNGG EVQEMAHIAN GRDPGNCVSL  600
LRVNSANSSQ SNMLILQESC TDSTGSYVIY APVDISAMNI VLSGGDPDYV ALLPSGFAIL  660
PDGPGYGSAG ILDVGSGGSL LTVAFQILVD SVPTAKLSLG SVATVNSLIK CTVERIKAAV  720
MCDNA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.7740.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G020400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2787661e-100GU278766.1 Populus balsamifera isolate POR11 haplotype A L1 specific homeobox gene (ML1) / ovulespecific homeobox protein A20 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454819.10.0homeobox-leucine zipper protein MERISTEM L1
RefseqXP_024454820.10.0homeobox-leucine zipper protein MERISTEM L1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLB9H1F80.0B9H1F8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s01980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]