PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G010000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 300aa    MW: 33504.2 Da    PI: 9.8139
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G010000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.9e-3251104255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrW+p+LH++Fv+ave LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Potri.004G010000.1  51 PRLRWAPDLHHCFVHAVEWLGGEDRATPKMVLQIMDVKGLTISHVKSHLQMYRS 104
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-3047106IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1449105IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2251105IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKKVEIESSL NKGSPSSSLD IRVTKRGVAG SLQEKNMKSA TVRPYVRSKM PRLRWAPDLH  60
HCFVHAVEWL GGEDRATPKM VLQIMDVKGL TISHVKSHLQ MYRSMKHEQM TQEAAMEAKK  120
NGKEPKIHHS NYLTHTMCCQ QNRQLNGKGL VNNNALLHQG RGAHNPANGL ALRNASFLTS  180
QRKDREGLWI GKKVNEPFLH EEKTSKEWEQ KPDNYIIFKD LLKSCNGTET NDQDKMSAGA  240
AGCNKSNQSL EELDEIAQRI DGDGMTLSLK SKVSESFLKP SKAKNSSDVN DVSLELTLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1752107358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1752107358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1752107358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1752107358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1752107459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G010000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495751e-121AC149575.1 Populus trichocarpa clone Pop1-41G18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383901.20.0myb family transcription factor PHL12
TrEMBLA0A3N7EVF10.0A0A3N7EVF1_POPTR; Uncharacterized protein
STRINGcassava4.1_021436m1e-106(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-33G2-like family protein