PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G210500.1
Common NamePOPTR_0003s22090g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 598aa    MW: 66752.8 Da    PI: 5.7394
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G210500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3434.78.9e-133394092350
                         XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                          l++rmwkd ++lkr+ke++k   ++++ a++++k ++ ++qarrkkm+raQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++r
  Potri.003G210500.1  39 ALERRMWKDHVKLKRIKEKQKL--AAQQ-AAEKQKPKQATDQARRKKMARAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIR 126
                         589***********99999885..3455.599*********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHH CS
                EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwge 183
                         aWWkekv+fd+ngpaai+ky+a++l+ ++++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww +
  Potri.003G210500.1 127 AWWKEKVKFDKNGPAAIAKYEAECLAIGEAENS--RNGNSQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWVK 215
                         ****************************99988..7899999************************************************* PP

                         HT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX......... CS
                EIN3 184 lglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss......... 265
                         lgls  q+ ppykkphdlkk+wkv+vLtavikhm p+i++ir+++rqsk+lqdkm+akes+++l vl++ee+++++ s ++          
  Potri.003G210500.1 216 LGLSLGQS-PPYKKPHDLKKMWKVGVLTAVIKHMTPDIAKIRRHVRQSKCLQDKMTAKESAIWLGVLSREESLIQQPSIDNGtsgvtespq 305
                         *******9.9*********************************************************************944445666544 PP

                         XXXX..XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...................XXXXXXXXXXXXXXXXXXXXX......XXXXXX CS
                EIN3 266 slrk..qspkvtlsceqkedvegkkeskikhvqavktta...................gfpvvrkrkkkpsesakvsskevsrtcqssqfr 335
                               q++k  +s+++++dv+g ++   + ++++++++                   + ++ +kr+++++ ++k s  +  ++    ++ 
  Potri.003G210500.1 306 G--GhgQKKKPAISSDSDYDVDGVDDGVGSVSSKDNRRNqpmdveplssrnditipvqDKELGEKRRRRKRPREKSSHADQQSQPPVDECL 394
                         3..045999*************87777778888888888999***********88888666666666555555555555555677777777 PP

                         X.XXXXXXXXXXXXX CS
                EIN3 336 gsetelifadknsis 350
                         g e+ ++++d n+++
  Potri.003G210500.1 395 GVEQTNTLPDINHTD 409
                         778888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.9E-12639285No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-70160292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.24E-62166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MGELEEIGAD ICSDIEVDDI RCGNIAEKDV SDEEIEAEAL ERRMWKDHVK LKRIKEKQKL  60
AAQQAAEKQK PKQATDQARR KKMARAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
ASDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAIGEAENSR NGNSQSVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWVKLGLSL GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMTP DIAKIRRHVR QSKCLQDKMT AKESAIWLGV LSREESLIQQ PSIDNGTSGV  300
TESPQGGHGQ KKKPAISSDS DYDVDGVDDG VGSVSSKDNR RNQPMDVEPL SSRNDITIPV  360
QDKELGEKRR RRKRPREKSS HADQQSQPPV DECLGVEQTN TLPDINHTDL QPVEYQMHNA  420
QHENFTSSAL MPMEKGLVGE SSLPQSDFNY YAGVPSTNVN STERIFVDRG AAIYPLGQNS  480
ELHHETTYSN IYNPSLDYGT NHGGKHSQMA MNVRPEDDRF LIPALHGNGN GNDLTGGEPH  540
HFAKDTLPPE QDTAVDRHFE FDLPDFAINS PFLEMSSFSL DNLFVDPEDD LIQCFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-761652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366374EKRRRRKRP
2367372KRRRRK
3367373KRRRRKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G210500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142770.0AC214277.1 Populus trichocarpa clone ACSB1145-L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386099.20.0ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_024454049.10.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A2K2BAD40.0A0A2K2BAD4_POPTR; Uncharacterized protein
STRINGPOPTR_0003s22090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-178ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]