PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G207100.1
Common NamePOPTR_0003s22300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 750aa    MW: 86587.8 Da    PI: 7.2324
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G207100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.53.9e-2728114191
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         +fY++YAk+vGF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk++++gkw+++++++eHnHel p
  Potri.003G207100.1  28 SFYKDYAKSVGFGTAKLSSRRSRSSKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQNGKWYIYSFVKEHNHELLP 114
                         5****************************************999877....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.3E-2528114IPR004330FAR1 DNA binding domain
PfamPF105513.1E-29227320IPR018289MULE transposase domain
PROSITE profilePS5096610.769507543IPR007527Zinc finger, SWIM-type
PfamPF044345.8E-9515541IPR007527Zinc finger, SWIM-type
SMARTSM005753.4E-8518545IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MDSSVITGST IPEPRDGIEF ESHEAAYSFY KDYAKSVGFG TAKLSSRRSR SSKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQNGKWY IYSFVKEHNH ELLPAQVHFF  120
RSHRNDDPLK NDIRIRRRKN LSSVSKLFGA YQNVDCLEGY MRNQQDKGRS LVLESGDAQV  180
LLDLFMHMQE ENPKFFYAVD LNEEHRLRNL FWVDTKGMED YSNFDDVVCF DTTYFTNKYK  240
IPLVFFIGVN HHIQPTLLGC ALIADETVYT FDWLMQTWFM AMGERAPQLM LTDQNNALKA  300
AIGAVFPQTC HCFCLWHILE KIPRQLEYLS LWHDNFMVKF NKCIFKSWTE EQFEKRWSKL  360
LDKFNLREVE WVRSLYEDRK YWVPAFMRDV SFAGLSTMSR SESLTSSYDK YVHAETSMRE  420
FIEQYKTILE DRYEEEAKAD FDAWHETAEL KSPSPFEKQM SLVYTHEIFR KFQVEVLGAA  480
ACHLKKESQD ETTTMYTVKD FEDGQNYVVE WNETKSDIYC SCRSFEYKGY LCRHAIVVLQ  540
MSGVFSIPPK YVLQRWTNAA LSRHPISERL DEVQTKVRRY NDLCRRAIIL GEEGSLSQES  600
YNIALCAIRE ALKQCASLNN SAETSACPNT SGSIEEENQY RNTSKERAPD LQVTGADKAT  660
RRAGAANTKE SNHSGAVKKG KQVTRSGDVN VGGQEGFHLM GISDLGPTQS HNMMPAQLQN  720
AVPTVFHNIM PTQFQNIAST HLHDTRLPR*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G207100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164090.0AC216409.1 Populus trichocarpa clone POP024-J08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024453616.10.0protein FAR1-RELATED SEQUENCE 4 isoform X1
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA0A2K2BA940.0A0A2K2BA94_POPTR; Uncharacterized protein
TrEMBLA0A385JI490.0A0A385JI49_POPTO; FAR1-related sequence 4
STRINGPOPTR_0003s22300.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]