PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G204400.1
Common NamePOPTR_0003s20320g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 238aa    MW: 26387.5 Da    PI: 6.4463
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G204400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.22e-0990134751
                         HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          +r + NReA r++R++Kka ++ Lee+vk+L   N++L  ++++
  Potri.003G204400.1  90 RKRPAGNREAVRKYREKKKAHTAYLEEEVKKLHLLNQQLVRKIQR 134
                         578899**********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.6E-1383152No hitNo description
SMARTSM003383.9E-1084151IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.02586152IPR004827Basic-leucine zipper domain
PfamPF077164.7E-1387133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-690134No hitNo description
CDDcd146863.33E-1090143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MKDYRMDDGE VELSDHVLLP DPGTSGSLQC SGSVDSLLDE LLKNTRTCTH THTCNPHGPD  60
AIHTHTCYHT HTQVIASEED DNPDNREHSR KRPAGNREAV RKYREKKKAH TAYLEEEVKK  120
LHLLNQQLVR KIQRQAILEA EVSRLRSILV DLRGKIDTEL GVFPFQNHCN TTTVLKEGEC  180
GAQSTGGLMN LQCQADLACF HTPTIVNCQA NTNNTANAEG HAMDMVEAFL PSASQAH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.174840.0leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G204400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1466300.0EF146630.1 Populus trichocarpa clone WS01210_O17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024452085.11e-178basic leucine zipper 23 isoform X1
RefseqXP_024452086.11e-178basic leucine zipper 23 isoform X1
SwissprotQ8GTS25e-54BZP23_ARATH; Basic leucine zipper 23
TrEMBLA9PE841e-177A9PE84_POPTR; Uncharacterized protein
STRINGPOPTR_0003s20320.11e-178(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-46bZIP family protein
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]