PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G202100.1
Common NamePOPTR_0003s20100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 477aa    MW: 53816.9 Da    PI: 6.6153
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G202100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS458.63.9e-140484711374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lLl+cA++v+ g+ e+a+  L+++s+laspdgd+mqR+aayft ALa r+++ +++l kal+p++ s    see+ +++lf+e++P+l
  Potri.003G202100.1  48 LIHLLLACANHVAVGSVENANISLEHISHLASPDGDTMQRIAAYFTAALADRILKGWPGLHKALNPKQVS--LISEEILVQRLFFELCPFL 136
                         689*****************************************************************98..79***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         k+s++++N+aI e++ege++vHiiD++ s+++QW++Llq+L++Rpegpp+lRiTg+++    +ke le+++ rL++ Ae+l++pf+fn+ +
  Potri.003G202100.1 137 KLSYVITNEAIIESMEGEKMVHIIDLNSSEPAQWINLLQTLSARPEGPPHLRITGIHE----KKEVLEQMALRLTEEAEKLDIPFQFNP-I 222
                         **********************************************************....9**************************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrll........................................................... 214
                         +++le+l+l +Lrvk+gEalaV++vlqlh ll                                                           
  Potri.003G202100.1 223 VSKLENLDLGNLRVKTGEALAVSSVLQLHALLamddemhkrnspsgsknpssnhfqrvlrmnqnrhtlgewlekdlvnvyssspdsalspl 313
                         999*********************************************************************************9997744 PP

                GRAS 215 ..desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacega 303
                           +     + + +++L++++slsPk++v++eqe++hn+ +++er+++al++y+alfd+le++++r+s er+kvE++l+g+ei+n++aceg+
  Potri.003G202100.1 314 slS----ASPKMSSFLNALRSLSPKLMVITEQESNHNEYTLMERVTKALNFYAALFDCLESTVSRASLERHKVEKMLFGEEIKNIIACEGT 400
                         333....3346677***************************************************************************** PP

                GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         er+erhe+lekW  rle aGF+++pls++   qa++ll+ ++ dgy+++ee+g+l+++W+drpL+svSaWr
  Potri.003G202100.1 401 ERKERHEKLEKWILRLELAGFGSIPLSYHGRLQANRLLQSYGYDGYKIKEENGCLLICWQDRPLFSVSAWR 471
                         **********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS0003201924IPR001827Homeobox protein, antennapedia type, conserved site
PROSITE profilePS5098557.20422451IPR005202Transcription factor GRAS
PfamPF035141.3E-13748471IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAGMVQEEGS SSVTSPPQFF PWMQLSPGIG SPYPWLRELK SEERGLCLIH LLLACANHVA  60
VGSVENANIS LEHISHLASP DGDTMQRIAA YFTAALADRI LKGWPGLHKA LNPKQVSLIS  120
EEILVQRLFF ELCPFLKLSY VITNEAIIES MEGEKMVHII DLNSSEPAQW INLLQTLSAR  180
PEGPPHLRIT GIHEKKEVLE QMALRLTEEA EKLDIPFQFN PIVSKLENLD LGNLRVKTGE  240
ALAVSSVLQL HALLAMDDEM HKRNSPSGSK NPSSNHFQRV LRMNQNRHTL GEWLEKDLVN  300
VYSSSPDSAL SPLSLSASPK MSSFLNALRS LSPKLMVITE QESNHNEYTL MERVTKALNF  360
YAALFDCLES TVSRASLERH KVEKMLFGEE IKNIIACEGT ERKERHEKLE KWILRLELAG  420
FGSIPLSYHG RLQANRLLQS YGYDGYKIKE ENGCLLICWQ DRPLFSVSAW RFKRYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-48484714375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1840730.0AC184073.2 Populus trichocarpa clone Pop1-50D1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303907.20.0hypothetical protein POPTR_0003s20100g
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLB9GWK50.0B9GWK5_POPTR; Uncharacterized protein
STRINGPOPTR_0003s20100.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25641433
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3