PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G174800.2
Common NamePOPTR_0003s17340g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 259aa    MW: 28865.6 Da    PI: 9.103
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G174800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.91.8e-20179213135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++Cg+ kTp+WR gpdg+ktLCnaCG++y++ +l
  Potri.003G174800.2 179 CQHCGVEKTPQWRAGPDGPKTLCNACGVRYKSGRL 213
                         *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.7E-18173223IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.637173209IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.28E-15175236No hitNo description
Gene3DG3DSA:3.30.50.101.7E-15177211IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.86E-15178226No hitNo description
PROSITE patternPS003440179204IPR000679Zinc finger, GATA-type
PfamPF003202.9E-18179213IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MESLDTAAGF MVDDLLDFCS DIGEGDDDEE HQNNNKKPRK GLPSLNPNAL ASASFNVLEH  60
TLLPEFAEEE LEWLSNKDAF PAVETCFGIL SEEPGSIPKH HSPVSVLENS TTSSTSISGN  120
SSNSSIIMSY CSLRVPVKAR SKRRHRRPRE IREQERWWSR ENSTRRKPAV SVAKMGRKCQ  180
HCGVEKTPQW RAGPDGPKTL CNACGVRYKS GRLVPEYRPA NSPTFSSKLH SNSHRKVVEM  240
RKQKQMMGSL VVKPMDKG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.106560.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G174800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1494820.0AC149482.1 Populus trichocarpa clone Pop1-69G3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303808.20.0GATA transcription factor 1
SwissprotQ8LAU96e-53GATA1_ARATH; GATA transcription factor 1
TrEMBLB9H0030.0B9H003_POPTR; Uncharacterized protein
STRINGPOPTR_0003s17340.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-52GATA transcription factor 1