PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G147200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 96aa    MW: 11456.3 Da    PI: 9.8932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G147200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.12e-1513511856
                        HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +Fe+++ p  e +++LA+++gL+ rqV +WFqNrRa+ k
  Potri.003G147200.1 13 FFESESRPELEIKQQLANEIGLEPRQVAIWFQNRRARLK 51
                        6999*********************************98 PP

2HD-ZIP_I/II90.22.5e-2913841788
         HD-ZIP_I/II 17 sFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88
                         Fe+e++ e e K++la+e+gl+prqva+WFqnrRAR ktkq+Ek+y+ Lk++y+al+++ e+L++e+++L 
  Potri.003G147200.1 13 FFESESRPELEIKQQLANEIGLEPRQVAIWFQNRRARLKTKQIEKEYSLLKANYEALASRFESLKRENQSLL 84
                        5889999999***********************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.3E-6557IPR001356Homeobox domain
SuperFamilySSF466892.82E-131364IPR009057Homeodomain-like
PfamPF000466.8E-131351IPR001356Homeobox domain
CDDcd000861.48E-91354No hitNo description
Gene3DG3DSA:1.10.10.605.8E-151360IPR009057Homeodomain-like
PROSITE profilePS5007113.8151453IPR001356Homeobox domain
PRINTSPR000312.3E-52433IPR000047Helix-turn-helix motif
PROSITE patternPS0002702851IPR017970Homeobox, conserved site
PRINTSPR000312.3E-53349IPR000047Helix-turn-helix motif
PfamPF021831.7E-145387IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MLFFKEYNSW KLFFESESRP ELEIKQQLAN EIGLEPRQVA IWFQNRRARL KTKQIEKEYS  60
LLKANYEALA SRFESLKREN QSLLIHVPFF FVVGL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14553RRARLKTKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:11374882, ECO:0000269|PubMed:15604708}.
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G147200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
UniProtINDUCTION: By water deficit, by abscisic acid (ABA), by cold and salt stress. {ECO:0000269|PubMed:15369784, ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087179.17e-35homeobox-leucine zipper protein ATHB-7
SwissprotP468971e-24ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
SwissprotQ9M2769e-25ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBLA0A2K2B7967e-61A0A2K2B796_POPTR; Uncharacterized protein
STRINGPOPTR_0003s14700.13e-42(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4008622
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.14e-27homeobox 12
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]
  3. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]