PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G146700.1
Common NamePOPTR_0003s14665g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 74aa    MW: 8276.66 Da    PI: 8.0613
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G146700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer51.42.5e-161853339
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaa 39
                          rYkeClkNhAa++ g+a+DGCgEf+p  +eeg+ +
  Potri.003G146700.1 18 VERYKECLKNHAATICGKAIDGCGEFIPG-EEEGSLE 53
                        579*************************9.5555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-92054IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.5E-132054IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-142053IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152319.1592172IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MDIPLQASRR IKRPYKKVER YKECLKNHAA TICGKAIDGC GEFIPGEEEG SLEAPQVLNL  60
ILIHDMILNR NIN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G146700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306012.23e-17zinc-finger homeodomain protein 3
RefseqXP_011005585.14e-17PREDICTED: zinc-finger homeodomain protein 3-like
TrEMBLB9GY331e-46B9GY33_POPTR; Uncharacterized protein
STRINGPOPTR_0004s14270.11e-16(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3952822
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.14e-15homeobox protein 21