PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G143000.2
Common NamePOPTR_0003s14300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 954aa    MW: 104676 Da    PI: 5.4899
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G143000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.56.3e-29574625152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle+l++yF++++kdAAk Lgvc+T++KriCRq+GI+RWP+Rki+++
  Potri.003G143000.2 574 AEKTISLEVLQQYFAGSLKDAAKRLGVCPTTMKRICRQHGISRWPSRKINKV 625
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.302564645IPR003035RWP-RK domain
PfamPF020426.0E-26577625IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22850941No hitNo description
SMARTSM006665.5E-25857939IPR000270PB1 domain
PROSITE profilePS5174524.619857939IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.6E-26857938No hitNo description
CDDcd064071.45E-34858938No hitNo description
PfamPF005646.8E-18858938IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 954 aa     Download sequence    Send to blast
MQKPIEGRGV GGGGGEPEGM KSMELDLDLD NSWPLDQISF MSSNPMSPFL ISTSTEQPCS  60
PLWAFSDAVD DRLAATASGQ ASPAFAAAAA PRLSDYPILL TCNPNLITES QGENDDNSKL  120
PSPFLGLMPI DNPDGYCMIK ERMTQALRYF KESTEQHVLA QVWAPVKNGG QHVLTTSGQP  180
FVLDPHSNGL HQYRMVSLMY MFSVDGESDR ELGLPGRVFR QKSPEWTPNV QYYSSKEYSR  240
LDHALRYNVR GTLALPVFEP SGQSCVGVLE LIMNSQKINY APEVDKVCKA LEAVNLKSSE  300
ILDPPSIQIC NEGRQNALSE ILEILTMVCE THKLPLAQTW VPCIHRSVLT YGGGLKKSCT  360
SFDGNCNGQV CMSTTDVAFY VVDARMWGFR EACLEHHLQK GQGVAGRAFL SQNSCFCPDI  420
TQFCKTEYPL VHYARMFGLT SCFAIFLRSS YTGDDDYILE FFLPPSITDS HEQKTFLGSI  480
LATMKQDFQS LKVASGMDLE EEGFVEMIEA TTNGRLECIQ IPQPTKSPPG DNMLPNEGHI  540
EQIDSEKNKL MFDLDVIKNG GRTKKPTERK RGKAEKTISL EVLQQYFAGS LKDAAKRLGV  600
CPTTMKRICR QHGISRWPSR KINKVNRSLS KLKWVIESVQ GTEGTFDLTP LTTSPLHVAD  660
GTISWPSNLN GSNQQTSPNS KPPEYHGNRN GSPTCRKPGS DGQAGSNRSK KRSGSRDGSA  720
GTPTSHDSCQ GSPENESAPV KDPSVSPVHE RCIKAGGSPG LALQQTKEQN LSSAYSIPDA  780
LVATEAHEPF GGMLIEDAGS SKDLRNLCPA VAEAIVDERV PESSWTDPPC FNMLPTQMFA  840
APLHAIPQAT PRQEMKSVTI KATYREDVIR FRISLSSGIV ELKEEVAKRL KLEVGTFDIK  900
YLDDDQEWVL IACDADLLEC MDVSRSSSSN IIRLSVHDAN ANLGSSCEST GEL*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. Detected in root hairs, emerging secondary roots, vascular tissues, leaf parenchyma cells and stomata. {ECO:0000269|PubMed:18826430}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G143000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024453644.10.0protein NLP7
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A2K2B7260.0A0A2K2B726_POPTR; Uncharacterized protein
STRINGPOPTR_0003s14300.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]