PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G142100.2
Common NamePOPTR_0003s14200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 549aa    MW: 61187.4 Da    PI: 6.9029
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G142100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.5e-2476176198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+kvlt sd++++g +++ +k+a+e+     ++++  +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +
  Potri.003G142100.2  76 FCKVLTASDTSTHGGFSVLRKHASEClppldMIQPIPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--R 164
                         99****************************9555555669************************************************..4 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Potri.003G142100.2 165 GENGELRVGVRR 176
                         49999*****98 PP

2Auxin_resp106.82.5e-35202281183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st + F v+Y+Pr+  s+F+++++k+++a+++k++vGmRfkm+fe+eds+err+sGt+vgv+d++p +W++SkWrsLk
  Potri.003G142100.2 202 ASHAISTLTLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPERRFSGTIVGVEDFSP-HWNDSKWRSLK 281
                         789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-3967205IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-4068191IPR015300DNA-binding pseudobarrel domain
CDDcd100175.47E-2274176No hitNo description
SMARTSM010195.6E-2476178IPR003340B3 DNA binding domain
PfamPF023622.6E-2276176IPR003340B3 DNA binding domain
PROSITE profilePS5086312.19676178IPR003340B3 DNA binding domain
PfamPF065072.1E-32202281IPR010525Auxin response factor
PfamPF023091.7E-11425525IPR033389AUX/IAA domain
SuperFamilySSF542776.38E-13430512No hitNo description
PROSITE profilePS5174526.72436517IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MEQLEASTNQ ELNQRVPLFN LPSKILCRVI NTQLLAEQET DEVYAQITLL PESDQIETTS  60
PDPCPSEPPR PTVHSFCKVL TASDTSTHGG FSVLRKHASE CLPPLDMIQP IPTQELVAKD  120
LHGYEWRFKH IFRGQPRRHL LTTGWSTFVT SKRLVAGDSF VFLRGENGEL RVGVRRVARQ  180
QSSMPSSVIS SQSMHLGVLA TASHAISTLT LFVVYYKPRT SQFIISLNKY LEAVNNKFAV  240
GMRFKMRFEG EDSPERRFSG TIVGVEDFSP HWNDSKWRSL KVQWDEPASI SRPDRVSPWE  300
IEPCVASVPA NLSQPVQPKN KRPRPPIEIP AFAMEDSKSV SPWPVFVGYS TPLSSKSKND  360
PIPDPSNKGR KYEVPTSYRL FGFDLVNQST SSSSPIEKVS AQPISVSRGA TDGRVLAALP  420
AVDSDQKHEQ SSTSTRSRTK VQLQGIAVGR AVDLTLIKGY GQLIDELEQL FDIKGQLHPR  480
DKWEIVYTDD EGDMMLVGDD PWPEFCNMVR RIFICSSQDV KKMSPGSKLP MLALEGEGTV  540
LSSDSAEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-160130349354Auxin response factor 1
4ldw_A1e-160130349354Auxin response factor 1
4ldw_B1e-160130349354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1320324KRPRP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G142100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022721655.10.0auxin response factor 9-like isoform X3
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A061GDF80.0A0A061GDF8_THECC; Auxin response factor
STRINGPOPTR_0003s14200.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9