PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G142100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 700aa    MW: 77703.6 Da    PI: 6.7926
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G142100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.23.7e-24131231198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+kvlt sd++++g +++ +k+a+e+     ++++  +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +
  Potri.003G142100.1 131 FCKVLTASDTSTHGGFSVLRKHASEClppldMIQPIPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--R 219
                         99****************************9555555669************************************************..4 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Potri.003G142100.1 220 GENGELRVGVRR 231
                         49999*****98 PP

2Auxin_resp106.33.5e-35257336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st + F v+Y+Pr+  s+F+++++k+++a+++k++vGmRfkm+fe+eds+err+sGt+vgv+d++p +W++SkWrsLk
  Potri.003G142100.1 257 ASHAISTLTLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPERRFSGTIVGVEDFSP-HWNDSKWRSLK 336
                         689***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-39122260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.0E-40123246IPR015300DNA-binding pseudobarrel domain
CDDcd100171.04E-21129231No hitNo description
SMARTSM010195.6E-24131233IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196131233IPR003340B3 DNA binding domain
PfamPF023623.8E-22131231IPR003340B3 DNA binding domain
PfamPF065072.9E-32257336IPR010525Auxin response factor
PfamPF023095.1E-12550676IPR033389AUX/IAA domain
SuperFamilySSF542778.34E-13580663No hitNo description
PROSITE profilePS5174526.72587668IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MMAMNRGGGG GSFSQANSEG CGEDDLYTEL WKACAGPLVD VPKRGERVFY FPQGHMEQLE  60
ASTNQELNQR VPLFNLPSKI LCRVINTQLL AEQETDEVYA QITLLPESDQ IETTSPDPCP  120
SEPPRPTVHS FCKVLTASDT STHGGFSVLR KHASECLPPL DMIQPIPTQE LVAKDLHGYE  180
WRFKHIFRGQ PRRHLLTTGW STFVTSKRLV AGDSFVFLRG ENGELRVGVR RVARQQSSMP  240
SSVISSQSMH LGVLATASHA ISTLTLFVVY YKPRTSQFII SLNKYLEAVN NKFAVGMRFK  300
MRFEGEDSPE RRFSGTIVGV EDFSPHWNDS KWRSLKVQWD EPASISRPDR VSPWEIEPCV  360
ASVPANLSQP VQPKNKRPRP PIEIPAFDLS STASTPWNSG LAQSCDLTQL SVTGEGKRNE  420
NHVMWHQKQT DINGHSNSMT RTQGEGGWLS SPHVNVSQHL FQEAMEDSKS VSPWPVFVGY  480
STPLSSKSKN DPIPDPSNKG RKYEVPTSYR LFGFDLVNQS TSSSSPIEKV SAQPISVSRG  540
ATDGRVLAAL PAVDSDQKHE VSKEKKPEQL HGSSKEIQSK QSSTSTRSRT KVQLQGIAVG  600
RAVDLTLIKG YGQLIDELEQ LFDIKGQLHP RDKWEIVYTD DEGDMMLVGD DPWPEFCNMV  660
RRIFICSSQD VKKMSPGSKL PMLALEGEGT VLSSDSAEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1792035813354Auxin response factor 1
4ldw_A1e-1792035813354Auxin response factor 1
4ldw_B1e-1792035813354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375379KRPRP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G142100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024453551.10.0auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A2K2B7070.0A0A2K2B707_POPTR; Auxin response factor
STRINGXP_002518850.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9