PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G118100.1
Common NamePOPTR_0003s11800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 202aa    MW: 22309.4 Da    PI: 10.2676
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G118100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC741.6e-23134177144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++l+ +k+C+rH+hrgr+rsrk  e
  Potri.003G118100.1 134 DPEPGRCRRTDGKKWRCSKEALPYQKYCDRHIHRGRQRSRKLEE 177
                         79**************************************9754 PP

2QLQ30.41.2e-116599337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT  Qlq+L  Q l+y y+ a+ PvP +L+++i++
  Potri.003G118100.1 65 FTVLQLQELQLQSLIYTYIQAGFPVPYHLVLPIWR 99
                        8888*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166616.3596499IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-86598IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.182134178IPR014977WRC domain
PfamPF088796.2E-20135175IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MESQAPPPKF ARLSNSRTRL ASGWNVERNR RDGESGSPPI GLGLELGRGG SSQRPIISCK  60
KPYGFTVLQL QELQLQSLIY TYIQAGFPVP YHLVLPIWRS VATSLGGLSS RLYQLYPSLM  120
GCNPLYLAYK NGMDPEPGRC RRTDGKKWRC SKEALPYQKY CDRHIHRGRQ RSRKLEESAS  180
HGNSSTDLSI SLPAGISGAS A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385746.11e-146hypothetical protein POPTR_0003s11800g
SwissprotQ6AWX72e-42GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLU5GJ981e-146U5GJ98_POPTR; Uncharacterized protein
STRINGPOPTR_0003s11800.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-27growth-regulating factor 2