PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G112800.2
Common NamePOPTR_0003s11230g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 141aa    MW: 15580.9 Da    PI: 8.1469
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G112800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY141.21.2e-43111403134
               YABBY   3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesas 93 
                         +  sseq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++      a + hl++s+  + ++ l    + +    +++ ++ 
  Potri.003G112800.2  11 LLPSSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLGHSFFSPSHNLLDEIPNPTPNFLINQ-TNV 100
                         5679*******************************************999999999999*****99885554444444433333333.233 PP

               YABBY  94 tsvsseklsenedeevprvppvirPPekrqrvPsaynrfik 134
                         ++ s+  +    d+e+pr+p ++rPPekrqrvPsaynrfik
  Potri.003G112800.2 101 NDFSV-PVRGMADHELPRPPVINRPPEKRQRVPSAYNRFIK 140
                         33333.345668999***999*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.2E-4014140IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSSSSTLSLD LLPSSEQLCY VHCNICDTVL AVSVPCTSLF KTVTVRCGHC TNLLPVNMRG  60
LLLPSANQFH LGHSFFSPSH NLLDEIPNPT PNFLINQTNV NDFSVPVRGM ADHELPRPPV  120
INRPPEKRQR VPSAYNRFIK *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.177050.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf primordia, young leaves, floret meristems, floral organ primordia, stamens and carpels. Does not show polar expression pattern. {ECO:0000269|PubMed:17216490, ECO:0000269|PubMed:17351053}.
UniprotTISSUE SPECIFICITY: Preferentially expressed in immature organs containing meristems and organ primordia. Expressed in phloem of developing vascular tissues of young seedling shoots. Expressed in the phloem of midvein vasculature of young leaves. Does not show polar expression pattern in leaf primordia. {ECO:0000269|PubMed:17216490, ECO:0000269|PubMed:17676337}.
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}.
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}.
UniProtSeems to be associated with phloem cell differentiation. {ECO:0000269|PubMed:17676337}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G112800.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304427.12e-98protein YABBY 4
SwissprotA2X7Q31e-39YAB4_ORYSI; Protein YABBY 4
SwissprotQ01JG21e-39YAB5_ORYSI; Protein YABBY 5
SwissprotQ0JBF01e-39YAB5_ORYSJ; Protein YABBY 5
SwissprotQ6H6681e-39YAB4_ORYSJ; Protein YABBY 4
TrEMBLB9GVI44e-97B9GVI4_POPTR; Uncharacterized protein
STRINGPOPTR_0003s11230.16e-98(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.11e-39YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Khanday I, et al.
    Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties.
    Plant Physiol., 2016. 172(1): p. 372-88
    [PMID:27457124]
  3. Yang C,Ma Y,Li J
    The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.
    J. Exp. Bot., 2016. 67(18): p. 5545-5556
    [PMID:27578842]