PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G100800.4
Common NamePOPTR_0003s10000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 343aa    MW: 38089.6 Da    PI: 9.3599
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G100800.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.45.1e-2379123145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCs+++ +++k+CErH++r+r+rsrk++e+
  Potri.003G100800.4  79 DSEPGRCRRTDGKKWRCSKDAHPDSKYCERHMNRSRNRSRKPVES 123
                         689***************************************986 PP

2QLQ56.67.7e-201953337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT +Q+++L++Q+l++K+L+a++PvPp Ll++i+k
  Potri.003G100800.4 19 FTMSQWHELEHQVLIFKCLNAGLPVPPSLLLPIRK 53
                        *********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.2561853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.0E-151952IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.4579123IPR014977WRC domain
PfamPF088791.1E-1981122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSNSSVTVAG VGSRSPPGFT MSQWHELEHQ VLIFKCLNAG LPVPPSLLLP IRKSFQLLSP  60
GFLHPSNLSY CSYFGKKIDS EPGRCRRTDG KKWRCSKDAH PDSKYCERHM NRSRNRSRKP  120
VESQTTSQSL STVASEIATG SSSIGSRGYP TNPGTLGLGS NMSRWQMESM PYGVNSKDYR  180
SLHGPKPEAD EKTFLPEALG NTRSFGMNST VDSTWHLTSQ VPANRVPESR NGSLLQNYPQ  240
VQTLQDFEPL TVDAASPKQQ QQQHYLFGRE FSSSGSMRRE NQSLQPLFDE WPKCRDMDSH  300
LTDQRSNNNS SAVQLSMAIP MAPNPAARSY HSPNVSEHGM LH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.84831e-170bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G100800.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385702.20.0growth-regulating factor 3 isoform X2
TrEMBLA0A2K2B4N60.0A0A2K2B4N6_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10000.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-38growth-regulating factor 2