PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G100100.2
Common NamePOPTR_0003s09940g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 280aa    MW: 31647.9 Da    PI: 10.1812
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G100100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-322781155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        +prlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Potri.003G100100.2 27 RPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 81
                        59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2312484IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-312482IPR009057Homeodomain-like
SuperFamilySSF466896.09E-162784IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-242882IPR006447Myb domain, plants
PfamPF002498.3E-92980IPR001005SANT/Myb domain
PfamPF143791.8E-22123169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEKTTFGGGG GSYPYENGVV MMTRDPRPRL RWTADLHDRF VDAVTKLGGP DKATPKSVLR  60
LMGLKGLTLY HLKSHLQKYR LGQQARRQNN TEQSKESRVR APQGQAPVHQ ESMKNKVQYR  120
EISVAEALNC QIEVQKTLQE KLEVQKKLQM RIEAQGKYLQ AILEKAQKSL SQNLNDDSNG  180
KLKATRAHLT GFNSAVYSLM ENLNAEDRKP SITDLKGINM KENGPAMHIQ REGQTQETKD  240
VKHHLQGDSI HFDLNTKGNY DFVSANGSEL ELKMLSYRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-192780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-192780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-192780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-192780154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G100100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024452915.10.0myb family transcription factor PHL11
TrEMBLA0A2K2B4M50.0A0A2K2B4M5_POPTR; Uncharacterized protein
STRINGPOPTR_0003s09940.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.17e-73G2-like family protein