PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G096000.2
Common NamePOPTR_0003s09470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 633aa    MW: 71861 Da    PI: 5.9939
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G096000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.86e-2187142156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Potri.003G096000.2  87 KKRYHRHTAAQIQEMEAMFKECPHPDDKQRMRLSQELGLKPRQVKFWFQNRRTQMK 142
                         688999***********************************************998 PP

2START158.84.3e-502855101206
                         HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
               START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                         ela++ ++elvk+  a+ep+W +    eng+evl  +e ++               ++ea r+++vv+m++ +lv  +ld + +W e ++ 
  Potri.003G096000.2 285 ELALSSMDELVKMCHANEPLWIRNI--ENGKEVLNLEEHGRMfpwpsnlkqnsseTRTEATRDCAVVIMNSITLVDAFLDAN-KWMELFPs 372
                         578999*******************..**********99999****************************************.******99 PP

                         ...EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
               START  78 ...kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            +a+t++vi++g     g l+lm+aelq+lsplvp R+ +f+R++ q  ++g+w+ivd  +d   ++  ++s+   +++pSg++i++++
  Potri.003G096000.2 373 ivaRAKTVQVITPGisgasGSLHLMYAELQVLSPLVPtRETYFLRFCHQnVEEGTWAIVDFPLDRLHDNI-QPSFPLYKRHPSGCVIQDMP 462
                         999**********************************************99*****************98.89999999************ PP

                         TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         ng+s+vtw+eh++ +++ +h+++ + v sg+a+ga +w+  lqrqce+
  Potri.003G096000.2 463 NGYSRVTWIEHAEIEEKPVHQIFSQYVYSGMAFGAHRWLTVLQRQCER 510
                         **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-2073145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2281149IPR009057Homeodomain-like
PROSITE profilePS5007117.0784144IPR001356Homeobox domain
SMARTSM003894.1E-2085148IPR001356Homeobox domain
PfamPF000461.8E-1887142IPR001356Homeobox domain
CDDcd000861.55E-1887145No hitNo description
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PROSITE profilePS5084842.932276513IPR002913START domain
SuperFamilySSF559615.36E-31278512No hitNo description
CDDcd088755.91E-113280509No hitNo description
SMARTSM002343.3E-29285510IPR002913START domain
PfamPF018521.3E-42285510IPR002913START domain
SuperFamilySSF559613.71E-6528613No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MFGDCQVMSN MGGNVVSSDN LYSSPIGNPN FSFMSSMPFH TFSPIIPKEE NGLVMRGKEE  60
MESGSGSEQL EDRSGNEQES SEQPPKKKRY HRHTAAQIQE MEAMFKECPH PDDKQRMRLS  120
QELGLKPRQV KFWFQNRRTQ MKAQQDRSDN LILRAENESL KNDNYRLQAE LRNLICPNCG  180
GQAMLGAIPF EELRLENARL RDELERVCCI TSRYGGRQIH SMVPVPSFVP PSLDLDMNMY  240
SRPFPEYLGT CTDMMPVPVP VLEEPSSFPE AGVVLMEEGK GLAMELALSS MDELVKMCHA  300
NEPLWIRNIE NGKEVLNLEE HGRMFPWPSN LKQNSSETRT EATRDCAVVI MNSITLVDAF  360
LDANKWMELF PSIVARAKTV QVITPGISGA SGSLHLMYAE LQVLSPLVPT RETYFLRFCH  420
QNVEEGTWAI VDFPLDRLHD NIQPSFPLYK RHPSGCVIQD MPNGYSRVTW IEHAEIEEKP  480
VHQIFSQYVY SGMAFGAHRW LTVLQRQCER VASLMARNIS DLGVIPSPEA RKNMMRLAQR  540
MIRIFSLNIS SSSGQSWTGL SDSYDDTVRI TTRKITEPGQ PNGVILSAVS TTWLPYPHYQ  600
VFDLLRDEHR RSQGPYVLCC LAGTSFQWEC LA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.110650.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in the L1 of apical inflorescence meristems, early flower primordia, carpel and stamen filament epidermis, ovule primordia, nucellus and chalaze. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G096000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1291827e-98GU129182.1 Populus deltoides transcription factor HEX (OCLHD) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303433.20.0homeobox-leucine zipper protein HDG5
RefseqXP_006385675.20.0homeobox-leucine zipper protein HDG5
RefseqXP_024452822.10.0homeobox-leucine zipper protein HDG5
RefseqXP_024452823.10.0homeobox-leucine zipper protein HDG5
RefseqXP_024452824.10.0homeobox-leucine zipper protein HDG5
RefseqXP_024452825.10.0homeobox-leucine zipper protein HDG5
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLB9GZI90.0B9GZI9_POPTR; Uncharacterized protein
STRINGPOPTR_0003s09470.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]