PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G087700.9
Common NamePOPTR_0003s08600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 546aa    MW: 61198.1 Da    PI: 6.4019
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G087700.9genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.35.2e-26309362155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +++WtpeLH++Fv++ve+L G ++A+P+++lelmkv++Lt+++v+SHLQkYR+
  Potri.003G087700.9 309 KMKVDWTPELHKKFVQVVEKL-GVDQAIPSRVLELMKVESLTRHNVASHLQKYRM 362
                         5689*****************.********************************7 PP

2Response_reg25.94.9e-10201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+ d++++ +  +++ le  +y +v ++ +  eal  + ++   +++ ++ ++ ++++G+  +k +++++ +lp i+ +     +++ ++
  Potri.003G087700.9  20 VLLLDEDNSSAAEIKSKLEALDY-IVYTFCNENEALLAISNEPgsFHVAIVEVSTSNSNGS--FKFLETAK-DLPTIMTSNIHCLNTMMKC 106
                         79999999***************.***************999889***************7..67777766.9****9999999******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp ++++l++
  Potri.003G087700.9 107 IALGAVEFLRKPLSEDKLRN 126
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521727.12E-1416134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.4E-1417169No hitNo description
PROSITE profilePS5011020.0119132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-620127IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.85E-821131No hitNo description
PROSITE profilePS5129414.044306365IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-25307363IPR009057Homeodomain-like
SuperFamilySSF466892.33E-17308365IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-24309363IPR006447Myb domain, plants
PfamPF002491.4E-7312361IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MVCTTNDLSA WKDFPKGLSV LLLDEDNSSA AEIKSKLEAL DYIVYTFCNE NEALLAISNE  60
PGSFHVAIVE VSTSNSNGSF KFLETAKDLP TIMTSNIHCL NTMMKCIALG AVEFLRKPLS  120
EDKLRNIWQH VVHKAFNAGG SVQSESLKPV KDSIVSMLEL KVELEENEDE NMEKTENASL  180
AQESNEQQSP ASDKHPAPST WQFKQVGRLL DDGDCQDHIN CSVEKDSGEQ EGESKSVETT  240
CAMSQETLKA GHPPCFIETV IKETGDLTDG AKSENNIHPN PQNKDSLNHS NDVASDLHTS  300
NGTRANRKKM KVDWTPELHK KFVQVVEKLG VDQAIPSRVL ELMKVESLTR HNVASHLQKY  360
RMRRRPILPK EDDRRWPHHR EQVQRSYYPY KPIMAYPPYH SNHDLPTNPV YPMWGATGSH  420
TASMHTWGTP SYLPWPPTEI WHRKPYLGMH ADAWGCPVMP PLHSPFSSFP QNASGFQSAS  480
MVDNSCGMPQ KPFDLQPAEE VINKVVKEVI NKPWLPLPIG LKPPSTDSVL AELSSRHQKI  540
RLNQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-15314362654Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.84700.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G087700.9
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0289200.0CT028920.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454054.10.0two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-133APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A2K2B3V30.0A0A2K2B3V3_POPTR; Uncharacterized protein
STRINGPOPTR_0003s08600.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.51e-127ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]