PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G083800.1
Common NamePOPTR_0003s08210g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 458aa    MW: 50734.4 Da    PI: 8.2966
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G083800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix54.62.8e-171899186
            trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                        +Wt++e laLi+a+r+++ +++rg+l+ ++We+v++++      +s+ qC++k+e+l+kry+++k+   k+  +  s++ +f  l+
  Potri.003G083800.1 18 CWTQEESLALIKAYRDKWYSVNRGNLRVADWEAVAAAVPL----KSSLQCRHKIEKLRKRYRAEKQKCLKHPGRFFSSWDLFPLLD 99
                        8***********************************9974....799*******************99999888888999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.3E-1517101No hitNo description
PROSITE profilePS500906.7131971IPR017877Myb-like domain
CDDcd001672.39E-51970No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MSTAPSSDFT TKRVPPPCWT QEESLALIKA YRDKWYSVNR GNLRVADWEA VAAAVPLKSS  60
LQCRHKIEKL RKRYRAEKQK CLKHPGRFFS SWDLFPLLDS MEIGSLGSKV EQEIDKGNDA  120
GDGICVKTLG DRYLLTAQKN GKINGDLDPD EVFDLDPDFA LRARKYSKVD GGFSVSKDSG  180
SGFGVSSVAF RPNDYVGVNG NIKANVGFNC DHGGEVVRLP DHGMMADHYG SYNSDFSKGV  240
DVYEGFPLKS LGDRNLPMQG LNPKNYKKID RKPTPDFCDD DHVEIDYRID KRDRFGKKVN  300
DGWSSSFPGF IPNNCGNIDG KSRSDSRSRA LKGSVNVGTN GIGDGVRREA DSVALLVSAI  360
EQATESFVKV EMMKMDMAME IEKMRMEMGL KHNQMILESQ QQIVDALAKA MLEKKKRRKV  420
EVLSSNSNRN GYTQVAAVDC ESIGKSSIVK ESEACVS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1413417KKKRR
2413418KKKRRK
3414418KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385573.10.0hypothetical protein POPTR_0003s08210g
TrEMBLB9N2V50.0B9N2V5_POPTR; Uncharacterized protein
STRINGPOPTR_0003s08210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF137971421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44730.12e-32Trihelix family protein