PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G079800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 355aa    MW: 39484.6 Da    PI: 7.1414
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G079800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.77.3e-122132412856
                         HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  28 eereeLAkklgLterqVkvWFqNrRakek 56 
                         +++  LAk+lgL  rqV vWFqNrRa+ k
  Potri.003G079800.1 213 KQKMALAKQLGLRPRQVEVWFQNRRARTK 241
                         68899**********************98 PP

2HD-ZIP_I/II93.32.6e-302122762691
         HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
  Potri.003G079800.1 212 QKQKMALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTAENRRLQKEVQELR-AL 276
                         589***********************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046189.2E-363111IPR006712HD-ZIP protein, N-terminal
SMARTSM003891.5E-6136247IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-15138162IPR009057Homeodomain-like
CDDcd000862.17E-8138244No hitNo description
Gene3DG3DSA:1.10.10.601.4E-15212246IPR009057Homeodomain-like
PROSITE profilePS5007112.374213243IPR001356Homeobox domain
PfamPF000463.0E-9213241IPR001356Homeobox domain
SuperFamilySSF466893.08E-10213251IPR009057Homeodomain-like
PRINTSPR000311.9E-5214223IPR000047Helix-turn-helix motif
PROSITE patternPS000270218241IPR017970Homeobox, conserved site
PRINTSPR000311.9E-5223239IPR000047Helix-turn-helix motif
CDDcd146860.00315236275No hitNo description
PfamPF021831.7E-11243277IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.0E-26243286IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMMAEKEDLG LSLSLSVPQN QHSLQFNLMP SLVPSTAASS LSGFNPQKPS WNATFPPSDQ  60
NSDPYRAETR SFLRGIDVNR LPSTADCEEE AGVSSPNSTI SSISGKRSER EGINGEEHEM  120
ERDYSRGISD EEDGDTSRKK LRLSKDQAAI LEESFKEHNT LNPSQKQGNT GGLPVFSEQP  180
NNATEKLFFL LGLDSEGILV IGADNLLFCY VQKQKMALAK QLGLRPRQVE VWFQNRRART  240
KLKQTEVDCE FLKRCCENLT AENRRLQKEV QELRALKLSP QFYMQMTPPT TLTMCPSCER  300
VAVPPSASST VDARSHPHMG PTPPHHRPIP INPWAPAAPI TRGPTPFDVL RPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142SRKKLRL
2235243RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.41770.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and stems. {ECO:0000269|PubMed:8106086}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G079800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385549.10.0homeobox-leucine zipper protein HAT4
SwissprotQ054661e-108HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLB9GYL80.0B9GYL8_POPTR; Uncharacterized protein
STRINGPOPTR_0003s07760.20.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-101homeobox protein 2
Publications ? help Back to Top
  1. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  4. Müller-Moulé P, et al.
    YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance.
    PeerJ, 2016. 4: p. e2574
    [PMID:27761349]
  5. Ivarson E, et al.
    Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre.
    Front Plant Sci, 2016. 7: p. 2032
    [PMID:28119714]
  6. Kasulin L, et al.
    A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina.
    Mol. Ecol., 2017. 26(13): p. 3389-3404
    [PMID:28316114]
  7. Singh M,Gupta A,Singh D,Khurana JP,Laxmi A
    Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth.
    Sci Rep, 2017. 7(1): p. 16101
    [PMID:29170398]