PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G065400.1
Common NameHNO1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 563aa    MW: 62427.9 Da    PI: 6.4598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G065400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS248.72.3e-761755542374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a++ g+l+++q+lL  l+elasp+gd+++Rlaa+ ++AL ++l++s++  ++++ + + ++++ +   +al  f+evsP++ 
  Potri.003G065400.1 175 EQLLNPCAAAITIGNLSRVQHLLYVLHELASPTGDANHRLAAHGLRALTHHLSSSSTVSSASIGTVTFASTEPKFFQKALLKFYEVSPWFA 265
                         689***************************************************7777778889999998888888888888********* PP

                GRAS  93 fshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfA 169
                         f + +aN  Il+ + +e    + +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++ + +++               +  +rL  fA
  Potri.003G065400.1 266 FPNNIANASILQVLGQEqdptRILHILDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVITATTENdqsteppfsIGPPGDNFPSRLLGFA 356
                         **************9998885566************************55566*******998777787777776667788999******* PP

                GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerf 257
                         + +++++e++ l    l++l+ + ++ kp+Eal+V+ +++lh+l    +++++er+e+ +++++l+Pk v+++e+++d+  ns ++F+++f
  Potri.003G065400.1 357 KFMNINLEIKRLDGYPLQKLSGRIIDAKPEEALIVCAQFRLHHLN---HNTPDERTEFFRVLRRLEPKGVILSENNMDCscNScGDFATGF 444
                         ***********9888*****************************8...77777889********************8875444259***** PP

                GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347
                         ++ ++y + ++ds+++ +    + r + Er++++ e +++++++g++    +e   kW er++ +GF    ++e+a + a++llrk++ ++
  Potri.003G065400.1 445 SRRVQYLWRFLDSTSSAF----KGRESEERRMMEGEGSKALTNRGEM----NEGIDKWCERMQGVGFVGEMFGEDAIDGARALLRKYDgNW 527
                         **************6664....4555555555555678889999988....9************************************999 PP

                GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++r   ++g++ l Wk++p+ ++S W+
  Potri.003G065400.1 528 EMRTGGKDGCVGLWWKGQPVSFCSLWK 554
                         9*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.009148533IPR005202Transcription factor GRAS
PfamPF035148.0E-74175554IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MTIEGSEPNQ ASDHILDWLE DSVSFLPSFL DDPYNAADID PYQWWEQAEE ICQDLANTNT  60
NTNTSLSSST TTSTITNINT TSLISPNNPT ISNHPPTSTS NKKRKDPEDL VPKTSQNHNQ  120
RRNLNHRINK EDQDGEAVVG EVVAVKKSNG NKKSTNKSTG NNSNNGNKKE GRWAEQLLNP  180
CAAAITIGNL SRVQHLLYVL HELASPTGDA NHRLAAHGLR ALTHHLSSSS TVSSASIGTV  240
TFASTEPKFF QKALLKFYEV SPWFAFPNNI ANASILQVLG QEQDPTRILH ILDIGVSHGV  300
QWPTLLEALT RRPGGPPPLV RITVITATTE NDQSTEPPFS IGPPGDNFPS RLLGFAKFMN  360
INLEIKRLDG YPLQKLSGRI IDAKPEEALI VCAQFRLHHL NHNTPDERTE FFRVLRRLEP  420
KGVILSENNM DCSCNSCGDF ATGFSRRVQY LWRFLDSTSS AFKGRESEER RMMEGEGSKA  480
LTNRGEMNEG IDKWCERMQG VGFVGEMFGE DAIDGARALL RKYDGNWEMR TGGKDGCVGL  540
WWKGQPVSFC SLWKLDMKGS DS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B5e-4317155430419Protein SHORT-ROOT
5b3h_E5e-4317155430419Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269|PubMed:15961669}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G065400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175880.0AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
GenBankAJ9724870.0AJ972487.1 Populus trichocarpa HNO1 gene for Nodulation Signaling Pathway 1 protein homologue 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304134.30.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLQ4VYC30.0Q4VYC3_POPTR; Nodulation Signaling Pathway 1 protein homologue 2
STRINGPOPTR_0003s06380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Representative plantOGRP40821525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-146GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]