PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G065000.1
Common NamePOPTR_0003s06360g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 343aa    MW: 38014.9 Da    PI: 7.643
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G065000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.4e-2579122144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Potri.003G065000.1  79 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 122
                         79***************************************986 PP

2QLQ58.32.2e-201548336
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        FTa+Q+++L++Q+l+yKy+++++PvPpeLl  ++
  Potri.003G065000.1 15 FTATQWHELEHQALIYKYMVSGVPVPPELLYSVK 48
                        *****************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-111349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.9351449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.9E-151547IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.71979123IPR014977WRC domain
PfamPF088791.2E-2080122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
SNMLNTTSAR NSLLFTATQW HELEHQALIY KYMVSGVPVP PELLYSVKRS LESSLASRLF  60
PHQPTGWGCF QAGAGRKADP EPGRCRRTDG KKWRCSKEAY PDSKYCERHM HRGKNRSRKP  120
VELASTTTTA AAAAIPLTSI NRNLYNNTVS PSSSSYSFSN LSSSMESEIY AHQDSSRSTF  180
LYPHSSSSGP PADSGFSPQN STTHNLFLDC GSSPHADKEY RYSHGIRECM DGRAFFPDAL  240
GSARGVQDSY NQLTMSSYKG YSQSQFQSFA NTSKEEQQQP GHHCFVLGTD IIKSSATRSI  300
KLEKEPETQK PLHHFFGEWE PKDADSGLDL ASSSKPDHDT DD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G065000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175880.0AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303244.30.0growth-regulating factor 5 isoform X1
TrEMBLA0A2K2B2J20.0A0A2K2B2J2_POPTR; Uncharacterized protein
STRINGPOPTR_0003s06360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-62growth-regulating factor 5