PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G052400.2
Common NamePOPTR_0003s05100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 614aa    MW: 68801.8 Da    PI: 7.1464
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G052400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.7e-21106161156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Potri.003G052400.2 106 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 161
                         7999************************************************9877 PP

2START228.51.9e-712734981206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                         e+a++a++el k+a+a+ep+W +s+    e++n+de++++f ++++       +s+ea+r+++vv+ +l++lv++++d++ +W+e+++   
  Potri.003G052400.2 273 EIANQAMEELKKMATAGEPLWIRSVetgrEILNYDEYTKEFGSENSsnngrpkRSIEASRETRVVFVDLPRLVQSFMDVN-RWKEMFPcli 362
                         57899************************************8887799********************************.********** PP

                         .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
               START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          ka+t++vi++g      ga+qlm+ae q+l+p+vp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksng
  Potri.003G052400.2 363 sKAATVDVICNGeganrnGAVQLMFAEVQMLTPMVPtREVYFVRYCKQLNAEQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNG 452
                         ******************************************************************98.9********************* PP

                         EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         h+kv+wveh +++++ +h ++r +v+sgla+ga++w atlq qce+
  Potri.003G052400.2 453 HCKVIWVEHLECQKSAVHTMFRTVVHSGLAFGARHWIATLQLQCER 498
                         ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2392157IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2195164IPR009057Homeodomain-like
PROSITE profilePS5007118.22103163IPR001356Homeobox domain
SMARTSM003898.3E-19105167IPR001356Homeobox domain
PfamPF000467.8E-19106161IPR001356Homeobox domain
CDDcd000862.55E-16110161No hitNo description
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PROSITE profilePS5084839.893264501IPR002913START domain
SuperFamilySSF559615.36E-33266498No hitNo description
CDDcd088755.45E-112268497No hitNo description
Gene3DG3DSA:3.30.530.201.3E-5272493IPR023393START-like domain
SMARTSM002341.2E-72273498IPR002913START domain
PfamPF018526.7E-57273498IPR002913START domain
SuperFamilySSF559619.06E-7520604No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MGVDMSNPPN SHIKDFFASP ALSLSLAGIF RGANVSHSAA AGSVEVEEGD EGSGGGRREE  60
TVEISSETSG PMRSRSDDDL EGEGEHDEDD GDGDGDDADK NKKKKRKKYH RHTAEQIREM  120
EALFKESPHP DEKQRQQLSK QLGLAPRQVK FWFQNRRTQI KAIQERHENS LLKTEMDKLR  180
EENKTMRETI NKACCPNCGT ATTSRGTALT TEEQQLRIEN AKLKAEVEKL RVVIGKYSPG  240
ATASCSAEND QENRSSLDFY TGIFGLDKTR ITEIANQAME ELKKMATAGE PLWIRSVETG  300
REILNYDEYT KEFGSENSSN NGRPKRSIEA SRETRVVFVD LPRLVQSFMD VNRWKEMFPC  360
LISKAATVDV ICNGEGANRN GAVQLMFAEV QMLTPMVPTR EVYFVRYCKQ LNAEQWAIVD  420
VSIDKVEDNI DASLVKCRKR PSGCIIEDKS NGHCKVIWVE HLECQKSAVH TMFRTVVHSG  480
LAFGARHWIA TLQLQCERLV FFMATNVPTK DSTGVATLAG RKSILKLAQR MTWSFCRAIG  540
ASSYHTWSKV SSKTGEDIRI SSRKNLNEPG EPVGLILCAV SSVWLPVPPH ILFDFLRDEA  600
RRNEVQQKMT LLS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101106KKKKRK
2101107KKKKRKK
3103107KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131650.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G052400.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304207.20.0homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLB9GXB60.0B9GXB6_POPTR; Uncharacterized protein
STRINGPOPTR_0003s05100.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]