PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G049100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 378aa    MW: 40690.5 Da    PI: 7.2826
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G049100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-12115159347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qk+
  Potri.003G049100.1 115 PWTEDEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKF 159
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.715108164IPR017930Myb domain
SuperFamilySSF466895.62E-16110165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-18111163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-10112155IPR009057Homeodomain-like
SMARTSM007173.5E-9112162IPR001005SANT/Myb domain
CDDcd001674.48E-8115160No hitNo description
PfamPF002491.6E-9115158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RSSLASSSSS PLSGVKLFGV RLTDGSIIKK SASMGNLSVH  60
YHSSSSAAAS PNPDSPLFDH VRDSAHVPDG YLSDDPAAHA SCSTNQRGDR KKGVPWTEDE  120
HRLFLIGLQK LGKGDWRGIA RNFVVSRTPT QVASHAQKFF IRQSNATRRK RRSSLFDMVP  180
EMATDPQPVP EEQELLSSSR AGDTGNADPL PSLNLSLKPE FEPMDIASQE LVKEPDKTVM  240
GLSEIKPIVP SSNESSTVVS GSSEFTAVPG FFPAYMPVPY PYWPPNTTSF EEGTVAAASH  300
HEVLKPVPII PKEPFVVDEL VGMSHLHLGE TDRHHREPSP LSLKLIGEPS RQSAFHASAP  360
AGGSDLSNGK ASSIQAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.106300.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G049100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1482410.0EF148241.1 Populus trichocarpa x Populus deltoides clone WS01312_B18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385451.20.0transcription factor MYBS3
TrEMBLA0A2K2B1N90.0A0A2K2B1N9_POPTR; Uncharacterized protein
STRINGXP_002515966.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-104MYB_related family protein