PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G048700.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Whirly
Protein Properties Length: 194aa    MW: 20857.8 Da    PI: 10.3618
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G048700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly164.62.7e-51531621110
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         sv+k+kaal+v++v+ptf++  sgnl+++r+G+++l++ +a++erkyd+ek+q+falsatev++l++ ++k+sceffhdp++ +sn+G+vr
  Potri.003G048700.2  53 SVFKGKAALSVEPVLPTFSKFGSGNLRVDRRGSMMLTFLPAIGERKYDYEKRQKFALSATEVGSLISTGPKDSCEFFHDPSMLSSNAGQVR 143
                         79***************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnls 110
                         k l+++P++dGsG+fv+l 
  Potri.003G048700.2 144 KNLSIKPHADGSGYFVSLI 162
                         *****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.4E-5343161IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.8E-4346161IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.4E-4754163IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MMKLSRFLNF NRNAVGKPTD VRDGSALHAL TFQASISTGG KSSIQDRVFA PYSVFKGKAA  60
LSVEPVLPTF SKFGSGNLRV DRRGSMMLTF LPAIGERKYD YEKRQKFALS ATEVGSLIST  120
GPKDSCEFFH DPSMLSSNAG QVRKNLSIKP HADGSGYFVS LICIAPHHGL GSVDYSTAWN  180
LSIKAVKSGS TNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A4e-674716110124Single-stranded DNA-binding protein WHY2, mit
4kop_B4e-674716110124Single-stranded DNA-binding protein WHY2, mit
4kop_C4e-674716110124Single-stranded DNA-binding protein WHY2, mit
4kop_D4e-674716110124Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.31390.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1460250.0EF146025.1 Populus trichocarpa clone WS0115_A07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303313.21e-115hypothetical protein POPTR_0003s04700g
SwissprotQ8VYF74e-68WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA9PCM91e-115A9PCM9_POPTR; Uncharacterized protein
STRINGPOPTR_0003s04700.11e-115(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.13e-69WHIRLY 2