PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G001000.1
Common NamePOPTR_0003s00890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 661aa    MW: 73555.5 Da    PI: 6.2389
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G001000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.81.8e-22123223198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F  
  Potri.003G001000.1 123 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL- 210
                         99****************************964333..4459************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          + +++el+v+v+r
  Potri.003G001000.1 211 -RGENGELRVGVRR 223
                         .449999*****97 PP

2Auxin_resp108.38.6e-36249331183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+ t++ F+v+Y+Pr+s+seF+v+++k+ +a ++k+svGmRfkm+fe+e+++err+sGt+vgv d  ++ W +S+WrsLk
  Potri.003G001000.1 249 ASHAIVTGTLFSVFYKPRTSRSEFIVNLNKYIEAQNHKLSVGMRFKMRFEGEEVPERRFSGTIVGVGDNISSGWADSEWRSLK 331
                         6899*****************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.76E-44113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.9E-41120238IPR015300DNA-binding pseudobarrel domain
CDDcd100177.15E-21121223No hitNo description
PfamPF023622.6E-20123223IPR003340B3 DNA binding domain
PROSITE profilePS5086311.279123225IPR003340B3 DNA binding domain
SMARTSM010191.0E-21123225IPR003340B3 DNA binding domain
PfamPF065073.5E-34249331IPR010525Auxin response factor
PfamPF023099.1E-7526570IPR033389AUX/IAA domain
PROSITE profilePS5174525.456534627IPR000270PB1 domain
SuperFamilySSF542771.05E-9537611No hitNo description
PfamPF023092.9E-6578624IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MNHTSGGNPH PGGCNDALYK ELWHACAGPL VTLPCEGERV YYFPQGHMEQ LEASMHQGME  60
QQMPSFNLPS KILCKVVNVQ RRAEPETDEV YAQITLLPEP DQSEVTSPDP PLPEPERCTV  120
HSFCKTLTAS DTSTHGGFSV LRRHADDCLP PLDMSQQPPW QELVATDLHG NEWHFRHIFR  180
GQPRRHLLTT GWSVFVSSKK LVAGDAFIFL RGENGELRVG VRRLMRQQTN MPSSVISSQS  240
MHLGVLATAS HAIVTGTLFS VFYKPRTSRS EFIVNLNKYI EAQNHKLSVG MRFKMRFEGE  300
EVPERRFSGT IVGVGDNISS GWADSEWRSL KVHWDEPSSI LRPERVSPWD LEPLVATTPS  360
NSQPMQRNKR PRPSVLPSPT ANLSALGMWK PSVESSAFSY GESQRGRDPY PSPNFSTTAK  420
ANSLSFCGNS QVTSVSPNSM YRPNQVESVT DSFAPVVNKD LGERRQGTGI GYRLFGIQLI  480
DNFNAEGTSP VVTVSGTVGN DRPVVSLEAE SDQHSEPEKS CLRSHQELQS RQIRSCTKVH  540
MQGVAVGRAV DLTQFEHYED LLRKLEEMFD IEGELSGSTK KWQVVYTDNE DDMMKVGDDP  600
WHEFCSMVKK IFIYASEEVK RLSPKIKLSG DEEIKGDSAN ANADASVNTE DRSSVVGPGC  660
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.023545355Auxin response factor 1
4ldw_A0.023545355Auxin response factor 1
4ldw_B0.023545355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368372KRPRP
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the sepals and carpels of young flower buds. At stage 10 of flower development, expression in the carpels becomes restricted to the style. Also expressed in anthers and filaments. At stage 13, expressed in the region at the top of the pedicel, including the abscission zone. {ECO:0000269|PubMed:16176952}.
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Acts as repressor of IAA2, IAA3 and IAA7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16176952}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.003G001000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1130350.0KM113035.1 Populus davidiana x Populus alba var. pyramidalis auxin response factor 1 family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385188.10.0auxin response factor 1
RefseqXP_024453403.10.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A1L6K4710.0A0A1L6K471_POPTO; Auxin response factor
TrEMBLU5GHK90.0U5GHK9_POPTR; Auxin response factor
STRINGPOPTR_0003s00890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Montesinos JC,Pastor-Cantizano N,Robinson DG,Marcote MJ,Aniento F
    Arabidopsis p24δ5 and p24δ9 facilitate Coat Protein I-dependent transport of the K/HDEL receptor ERD2 from the Golgi to the endoplasmic reticulum.
    Plant J., 2014. 80(6): p. 1014-30
    [PMID:25312353]
  2. Marais C, et al.
    The Qb-SNARE Memb11 interacts specifically with Arf1 in the Golgi apparatus of Arabidopsis thaliana.
    J. Exp. Bot., 2015. 66(21): p. 6665-78
    [PMID:26208648]
  3. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  4. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]