PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G230200.1
Common NamePOPTR_0002s23080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 766aa    MW: 83840.9 Da    PI: 5.7827
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G230200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2096151156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.002G230200.1  96 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 151
                         688999***********************************************999 PP

2START220.55.3e-692855051206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++el+++a+ +ep+W+ s       +n+de++++f+ + +     ++ ea+r+s+vv+m++ +lve l+d++ qW++ +     +
  Potri.002G230200.1 285 ELAVAAMEELIRMAQMDEPLWMNSLdgidAVLNEDEYIRIFPHGIGpkptgFKCEASRESAVVIMNHINLVEYLMDVN-QWSTLFSgivsR 374
                         57899********************999999**********99999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlev+s+g      galq+m+ae+q+++plvp R++++vRy++q+ +g+w++vdvS+ds ++ p     +R++++pSg+li++++ng+s
  Potri.002G230200.1 375 ALTLEVLSTGvagnynGALQVMTAEFQLPTPLVPtRESYYVRYCKQHADGTWAVVDVSLDSIRPGPA----ARCRRRPSGCLIQEMPNGYS 461
                         ******************************************************************5....******************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Potri.002G230200.1 462 KVTWVEHVEVDDRGVHNLYKHLVSSGHAFGAKRWVATLNRQCER 505
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2274151IPR009057Homeodomain-like
SuperFamilySSF466891.3E-1984153IPR009057Homeodomain-like
PROSITE profilePS5007116.95793153IPR001356Homeobox domain
SMARTSM003894.8E-2094157IPR001356Homeobox domain
PfamPF000464.3E-1896151IPR001356Homeobox domain
CDDcd000862.73E-1996154No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
SuperFamilySSF559618.24E-36276507No hitNo description
PROSITE profilePS5084844.182276508IPR002913START domain
CDDcd088756.09E-128280504No hitNo description
SMARTSM002341.1E-65285505IPR002913START domain
PfamPF018528.9E-59286505IPR002913START domain
Gene3DG3DSA:3.30.530.208.2E-6381503IPR023393START-like domain
SuperFamilySSF559615.08E-24524757No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MPAGVMIPAR NMPSMIGVNG NVGGFGSSSG LALGQIMFQP NMMEGHEFHH LDMTHNTSEG  60
DMTRIRDEEF DSTNTKSGSE NQEGASGDDQ DPRPKKKRYH RHTQHQIQEM EAFFKECPHP  120
DDKQRKELSR ELGLEPLQVK FWFQNKRTQM KTQHERHENT QLRNENEKLR ADNMRYREAL  180
SNASCPNCGG PTAIGEMSFD EHHLRLENTR LREEIDRISA IAARYVGKPV VNYPVLSPPM  240
PPRPVDLGVG NFGGQPGLGG DIYEAGDLLR SISAPTEADK PMIIELAVAA MEELIRMAQM  300
DEPLWMNSLD GIDAVLNEDE YIRIFPHGIG PKPTGFKCEA SRESAVVIMN HINLVEYLMD  360
VNQWSTLFSG IVSRALTLEV LSTGVAGNYN GALQVMTAEF QLPTPLVPTR ESYYVRYCKQ  420
HADGTWAVVD VSLDSIRPGP AARCRRRPSG CLIQEMPNGY SKVTWVEHVE VDDRGVHNLY  480
KHLVSSGHAF GAKRWVATLN RQCERLASAM ATNIPAGDAG VITNQEGRKS MMKLAERMVI  540
SFCAGVSAST AHTWTTLSGT GADDVRVMTR KSVDDPGRPP GIVLSAATSF WLPVPPKRVF  600
DFLRDENTRN EWDILSNGGV VQEMAHIANG RDTGNCVSLI RVNSANSSQS NMLILQESCT  660
DQTASFVIYA PVDIVAMNVV LNGGDPDYVA LLPSGFAIFP DGTAAHGVGM DESGSTGGSL  720
LTVAFQILVD SVPTAKLSLG SVATVNNLIA CTVERIKASL SCESA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.35720.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hairless cell files of the hypocotyl epidermis. Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in primary root tips, in the L1 of apical inflorescence meristems, early flower primordia, carpel epidermis, ovule primordia, nucellus, chalaze and seed coat. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G230200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166771e-161AC216677.1 Populus trichocarpa clone POP103-G02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450360.10.0homeobox-leucine zipper protein HDG2 isoform X1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A2K2BN310.0A0A2K2BN31_POPTR; Uncharacterized protein
STRINGPOPTR_0002s23080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2