PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G214500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 417aa    MW: 45631.1 Da    PI: 5.3337
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G214500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.73.7e-06444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ ++e++   +C+++  +lC +C +  H+       H++
  Potri.002G214500.1  4 ICDFCGEQRSMVYCRSDAACLCLSCDQIVHSAnalskrHSR 44
                        7**************************99955667777765 PP

2CCT60.17.6e-21359402144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R  a++RY eK+ktRkFeKk+rY+sRKa+A+ R RvKGrFvk+ 
  Potri.002G214500.1 359 RSDAVKRYMEKKKTRKFEKKVRYASRKARADVRRRVKGRFVKAG 402
                         889**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.684147IPR000315B-box-type zinc finger
CDDcd000213.45E-7447No hitNo description
SMARTSM003365.3E-7447IPR000315B-box-type zinc finger
PROSITE profilePS5101714.862359401IPR010402CCT domain
PfamPF062031.3E-15359401IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGYICDFCGE QRSMVYCRSD AACLCLSCDQ IVHSANALSK RHSRTLLCER CNSQPALVRR  60
VEERISLCQN CDWMGYGSST SASTHKRQTI NCYFGCPSVS ELSSKWPFIL DFPSGGGSTC  120
EQELGLMSIA ENSTKNTLGP TENTICHNAS GIVGVNDRCE IAKSGVWHEA SSVPESSSVP  180
NNLDQPTRSP NSSLPKLYCP GTKCPARYED ADLYEDFNMA EMDLNLENYE ELFGVTLNNS  240
EELFENGGID SLFGTKDMPI VDSNCQGAFA AEGSSVGLVN TIQPTCSNAP STDSMISSKT  300
EPILCFTAKQ GHSSLSFSGL TGESNAEDYQ DCGASSMLLM GEPSWCPPCL ESPLPSANRS  360
DAVKRYMEKK KTRKFEKKVR YASRKARADV RRRVKGRFVK AGDAYDYDPL SQTRSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G214500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2149950.0AC214995.1 Populus trichocarpa clone POP004-B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302823.30.0zinc finger protein CONSTANS-LIKE 9 isoform X1
RefseqXP_024451197.10.0zinc finger protein CONSTANS-LIKE 9 isoform X1
RefseqXP_024451198.10.0zinc finger protein CONSTANS-LIKE 9 isoform X1
SwissprotQ9SSE51e-143COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A2K2BMC80.0A0A2K2BMC8_POPTR; Uncharacterized protein
STRINGEOX935730.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-121CONSTANS-like 9