PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G195600.1
Common NamePOPTR_0002s19660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 565aa    MW: 64182.6 Da    PI: 7.8611
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G195600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.91.4e-881815491374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl.fsevsP 89 
                         l++lLl+ Ae v  +++ +a++lL+r +  as++ +p+qR++ yf+eAL+ r+++ ++  + + ++ +++ e+ +  +++  +l  ++  P
  Potri.002G195600.1 181 LTHLLLATAEKVGYQQFDRASRLLSRCEWVASERSNPLQRVVYYFAEALQGRIHKaTGRFIPEEMKGKPNCETLHGLSTHLAHLsMHQNVP 271
                         579****************************************************67777788887777776664444444444599999* PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         i ++ +lta qaI e v +++++H iD++i  G+QW aL+qaLa+R++   +l+iT+vg       +++eetg+rL+ fA++++ pf f++
  Potri.002G195600.1 272 ISQVMQLTAIQAIIENVGSARKIHLIDLEIRSGVQWTALMQALADRQRRLDHLKITAVGL---RGIQKIEETGKRLEIFARSMNFPFTFKP 359
                         ***********************************************************9...5799************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         + ++ +++++ e +++  +Ea++V   + l ++l+++++le+    +++++k+l+P +++v e ea+hns++F++rf+eal +y a fd+l
  Potri.002G195600.1 360 IQVSCMSEIKEELFETAADEAMVVVANMILRTMLSRPACLEN----LMRVIKNLNPSIMIVGEVEANHNSPTFVNRFIEALFFYGAYFDCL 446
                         ****************************************99....********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e+ l +++e+r+  E+  +++ i+n+v++eg++r++r  ++  Wr+ ++++ + +v +se+   qa l+ ++++ +   ++e++ ++l+ g
  Potri.002G195600.1 447 ETCLKQNTEHRTITEAT-FSNGIENIVTMEGTDRIARSVKMDVWRAFFSRFRMVEVGFSESSLYQAGLIPKQFPcGSSCTLEKNGKCLIVG 536
                         ****8888888888888.********************************************************9999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+ pL s+SaW+
  Potri.002G195600.1 537 WKGTPLHSLSAWK 549
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.055155528IPR005202Transcription factor GRAS
PfamPF035144.9E-86181549IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MIKGEKSRLF SMEDLGQVYP LCSEYGAYQD NTENKGLNFF RDQQQPQQQQ SPPKSSYLTL  60
DDFLGSCLPA PAQPMQEIKR LESIAKNSKE TLYTPALSSS LQLLRKYGSR KEIECSQLGG  120
ASDETWFSTR KKLSTEEIIR VAGSRFIQFS DQRYDDFSML MHPFGYALSG LSEEETRDVE  180
LTHLLLATAE KVGYQQFDRA SRLLSRCEWV ASERSNPLQR VVYYFAEALQ GRIHKATGRF  240
IPEEMKGKPN CETLHGLSTH LAHLSMHQNV PISQVMQLTA IQAIIENVGS ARKIHLIDLE  300
IRSGVQWTAL MQALADRQRR LDHLKITAVG LRGIQKIEET GKRLEIFARS MNFPFTFKPI  360
QVSCMSEIKE ELFETAADEA MVVVANMILR TMLSRPACLE NLMRVIKNLN PSIMIVGEVE  420
ANHNSPTFVN RFIEALFFYG AYFDCLETCL KQNTEHRTIT EATFSNGIEN IVTMEGTDRI  480
ARSVKMDVWR AFFSRFRMVE VGFSESSLYQ AGLIPKQFPC GSSCTLEKNG KCLIVGWKGT  540
PLHSLSAWKF STERLWRPLA NNNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3520454926375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302767.10.0hypothetical protein POPTR_0002s19660g
TrEMBLB9GST20.0B9GST2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s19660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-61RGA-like 2