PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G180800.3
Common NamePOPTR_0002s18190g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 769aa    MW: 83888.2 Da    PI: 6.481
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G180800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Potri.002G180800.3 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.4E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.2E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-82464IPR009057Homeodomain-like
CDDcd001671.49E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MDTYSAGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVAKG VPIGKALEID IPPPRPKRKP SNPYPRKTGV GPPASQAGAK  120
DGKLLTSTSS PHCRKVLDLE KEPRPEKPNG DERPTNAKEN QDDNCSEVFT LLQEAHCSSV  180
ASVNKNCVPA LEVLKKTSSF REFVPSPKKG NHDACNESFI TVEHEANQKL DSSDANQTVL  240
DNGTVKASKS ENSCSLHEIL FQQKKSDDFI GSLPTDEMKA MQNYPRHVPV HVLDGSLGTC  300
METPSDLSFQ DSMFHPVGDI PACPILYSHP TGSTTTDHPT NLPRSSMHQS FPFFPPPFTP  360
THHNQDDYRS FLHISSTFSS PVVSTLLQNP AAHAAASFAA TFWPYGNVES SADSPACAQE  420
GFQSGQINSA PSMAAIAAAT VAAATAWWAA HGLLPICAPL HTAFACPPAS ATAIQSADTD  480
QVPPAKPERK ETTPDNPPLQ GQIQDLEHSE AVQAQNSASK PPTLSSSDSE ESGGTKLNTA  540
PKVTDHELNS KAPEVQDSGK TKSRKQVDRS SCGSNTPSSS EIETDALEKN EKGKEEPKEA  600
DANHPASELN CRRSRSSSSM SDSWKEVSEE GRLAFQALFT RERLPQSFSP PHDLKSKMHQ  660
KEDTEEKKNP DEKDGDASLL DLNSKTWGYC SGYQEGEKNA VVPRCVNDGE EGLLTIGLGH  720
GNLKAHLTGF KPYKRCSLEA KESRMGTTGG QGEEKGPKRL RLEREASV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G180800.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4294100.0AB429410.1 Populus nigra PnLHY1 mRNA for transcription factor LHY, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386664.10.0protein LHY
RefseqXP_024451481.10.0protein LHY
TrEMBLB9GRS20.0B9GRS2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18190.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-119MYB_related family protein