PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G177000.1
Common NamePOPTR_0002s17760g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 193aa    MW: 21746 Da    PI: 10.8283
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G177000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.91.5e-10107149345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +WT +E+el++ + +++G  +  +I+r++ k++ l q+k++ +
  Potri.002G177000.1 107 AWTDQEHELFLMGLRKYGRANYGKISRKFVKTKNLQQVKNHAN 149
                         7*****************99*********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129312.107103156IPR017884SANT domain
SMARTSM007172.3E-6104154IPR001005SANT/Myb domain
CDDcd001671.28E-6107152No hitNo description
PfamPF002492.5E-6107149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-6107147IPR009057Homeodomain-like
SuperFamilySSF466891.44E-9108152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MENQSDASKS PLSPPNPKEK HIRFNSPPPP PPPPSKINIE GPHLPMIKDN VSCLRGTVEP  60
ERRPNMNGKN KNIDFNMHRK MENFEKMISE GVKKFVKEYY KKNPDEAWTD QEHELFLMGL  120
RKYGRANYGK ISRKFVKTKN LQQVKNHANL VFRISGQLLK SSTRKGPNTK VGVAKSDPAA  180
ANIASTSQRR GA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G177000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023465.13e-57PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A2K2BKE41e-139A0A2K2BKE4_POPTR; Uncharacterized protein
STRINGPOPTR_0002s17760.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2821333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-11MYB family protein