PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G176300.1
Common NamePOPTR_0002s17680g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27282.4 Da    PI: 4.7426
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G176300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81.1e-193084256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++++f++eq++ Le++Fe++  +  +++ +LAk+lgL+ rqV +WFqN+Ra++k
  Potri.002G176300.1 30 KNKRRFSDEQIKSLESMFESETRLEPRKKMQLAKELGLQPRQVAIWFQNKRARWK 84
                        67889*************************************************9 PP

2HD-ZIP_I/II121.93.1e-3931122293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +krr+s+eq+k+LE++Fe+e++Lep++K++la+eLglqprqva+WFqn+RAR+k+kqlE+d++ L+++y++l+++ e+L+ke+++L  +l+
  Potri.002G176300.1  31 NKRRFSDEQIKSLESMFESETRLEPRKKMQLAKELGLQPRQVAIWFQNKRARWKSKQLERDFSILRANYNSLASRFETLKKEKQALVIQLQ 121
                         79************************************************************************************99987 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Potri.002G176300.1 122 K 122
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.97E-20888IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-202087IPR009057Homeodomain-like
PROSITE profilePS5007118.5442686IPR001356Homeobox domain
SMARTSM003896.9E-172890IPR001356Homeobox domain
PfamPF000465.0E-173084IPR001356Homeobox domain
CDDcd000861.91E-153587No hitNo description
PRINTSPR000316.2E-65766IPR000047Helix-turn-helix motif
PROSITE patternPS0002706184IPR017970Homeobox, conserved site
PRINTSPR000316.2E-66682IPR000047Helix-turn-helix motif
PfamPF021832.9E-1586127IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MFDGGEYSPS ATEPFSCMNG VTTSRKKKNK NKRRFSDEQI KSLESMFESE TRLEPRKKMQ  60
LAKELGLQPR QVAIWFQNKR ARWKSKQLER DFSILRANYN SLASRFETLK KEKQALVIQL  120
QKINDLMKKP GEEGECCGQG PAVNSIEGKS ENADTTMGES ETNPRLSIER PEHGLGVLSD  180
EDSSIKAEYF ELEEEPNLIS MVEPADGSLT SQEDWGSLDS DRLFDQSSSD YQWWDFWA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.58260.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G176300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2266150.0CU226615.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302659.11e-176homeobox-leucine zipper protein ATHB-7
SwissprotP468971e-76ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLB9GR611e-175B9GR61_POPTR; Uncharacterized protein
STRINGPOPTR_0002s17680.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56353452
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.16e-73homeobox 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]