PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G172800.1
Common NamePOPTR_0002s17350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 687aa    MW: 76547.2 Da    PI: 6.5168
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G172800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.36.2e-23116216198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +  
  Potri.002G172800.1 116 FCKILTASDTSTHGGFSVLRKHATEClppldMSQATPTQELAARDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR-- 204
                         99****************************9555566679************************************************3.. PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Potri.002G172800.1 205 GHNRELRVGVRR 216
                         378889***998 PP

2Auxin_resp94.12.2e-31242321183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+ t++ F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++S WrsLk
  Potri.002G172800.1 242 ASHAVLTQTLFVVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDISP-EWSGSIWRSLK 321
                         68999*************6..99**********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.11E-41107245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-39109231IPR015300DNA-binding pseudobarrel domain
CDDcd100176.63E-19114216No hitNo description
PfamPF023626.0E-21116216IPR003340B3 DNA binding domain
PROSITE profilePS5086311.321116218IPR003340B3 DNA binding domain
SMARTSM010191.9E-21116218IPR003340B3 DNA binding domain
PfamPF065071.3E-29242321IPR010525Auxin response factor
PfamPF023093.0E-6550607IPR033389AUX/IAA domain
SuperFamilySSF542771.9E-12566647No hitNo description
PROSITE profilePS5174525.856571652IPR000270PB1 domain
PfamPF023095.6E-6617655IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MAHAERGCDD LYTELWKACA GPLVDVPKDG ERVFYFPQGH MEQLEASTNQ ELNQQIPRFN  60
LPPKILCRVV NIQLLAEQDT DEVYAQITLH PEVDQTEPTS PDPCPPEPAK PTIHSFCKIL  120
TASDTSTHGG FSVLRKHATE CLPPLDMSQA TPTQELAARD LHGFEWRFKH IFRGQPRRHL  180
LTTGWSTFVT SKRLVAGDAF VFLRGHNREL RVGVRRLARQ QSSIPSSVIS SQSMHLGVLA  240
TASHAVLTQT LFVVYYKPRT NQYIIGLNKY LEAVKNGFSV GMRFKMRFEG EDSPERRFTG  300
TIVGVGDISP EWSGSIWRSL KIQWDEPATI QRPERVSPWD IEPFAAPASP NLTQQVMKTK  360
RPRPTDIPTS AASSFWYHGS TQSHELAQLG SSNEVQSSES HVWSMRQKEI DSSLLNNSSS  420
SNTRARPEGI WPSSPNMNVS LNFFPDSVGD NNFATTRSII SGFSSPISSR QSNCLINEQV  480
EKGRKYENSV GCRLFGIDLT SNSGSSAPPE KEPGYPIVDS NGTKGLVPAA SEAERAQAMD  540
VSMYSKEQKQ VLSEAMVKES QSKQGSTTSM RTRTKVQMQG IAVGRALDLT VLKGYRDLIY  600
ELEKMFEIEG ELSTPNKWAV VFTDDEGDMM LVGDDPWPEF CKMVKKIFIY SSEEVKKTGT  660
RCKLPASSFE GEETVVSMDS DHRSDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-176934417355Auxin response factor 1
4ldw_A1e-176934417355Auxin response factor 1
4ldw_B1e-176934417355Auxin response factor 1
4ldx_A1e-176934417355Auxin response factor 1
4ldx_B1e-176934417355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1359363KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.68130.0catkin
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G172800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024451070.10.0auxin response factor 18 isoform X3
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A2K2BK810.0A0A2K2BK81_POPTR; Auxin response factor
STRINGPOPTR_0002s17350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]