PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G163100.1
Common NamePOPTR_0002s16460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 364aa    MW: 39979.6 Da    PI: 7.9738
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G163100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-1392136147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Potri.002G163100.1  92 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 136
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1686142IPR009057Homeodomain-like
PROSITE profilePS5129415.40887141IPR017930Myb domain
TIGRFAMsTIGR015571.7E-1890139IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-690142IPR009057Homeodomain-like
SMARTSM007175.3E-1191139IPR001005SANT/Myb domain
PfamPF002493.1E-1192136IPR001005SANT/Myb domain
CDDcd001672.50E-894137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYFFDPMNN SNMGLPGLDS LPPPPTTTAA TPSNTATATA TNTCKNTVST  60
VNTNNNHNNT VMSFSEDSSK KIRKPYTITK SRESWTEQEH DKFLEALQLF DRDWKKIEAF  120
VGSKTVIQIR SHAQKYFLKV QKSGTSEHVP PPRPKRKAAH PYPQKASKSA VVASQATGLF  180
QSSSTLLEPG YLYRPDTTSD LGNPITSGSS STWSYNSGPP VNMSQMTTDD AGLAGPTISY  240
KCCYSSSNES TPRTWQAGKI IDNKDQGKPE RVMPDFAQVY SFIGSVFDPN ARDHLQRLKQ  300
MDPINLETVV LLMRNLSVNL TSPEFEDHRR LLASYDVDSE KENSGGSYSN CSVDNLGNPI  360
PAM*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G163100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684812e-72EF468481.1 Medicago truncatula MYB transcription factor MYB40 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024449945.10.0protein REVEILLE 5
SwissprotC0SVG51e-110RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A2K2BJT10.0A0A2K2BJT1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s16460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.28e-89MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]