PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G154700.1
Common NamePOPTR_0002s15610g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89297.3 Da    PI: 6.2784
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G154700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-21117172156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Potri.002G154700.1 117 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 172
                         688999***********************************************999 PP

2START194.64.7e-613265511206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+++ +ep+W  s     e++n + +l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
  Potri.002G154700.1 326 ELALAAMDELVKMVQTDEPLWIGSFeggrEILNHEGYLRTFTPCIGmkpsgFVSEASRETGMVIINSLALVETLMDSN-RWAEMFPcmiaR 415
                         5899******************9999****************999899******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t++vi sg      g lqlm+ael +lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +v +++lpSg+++++++ng+
  Potri.002G154700.1 416 TSTTDVIASGmggtrnGSLQLMQAELHVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRDTSGaPPTFVNCRRLPSGCVVQDMPNGY 506
                         ****************************************************************999999********************* PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         skvtwveh+ +++r++h+l+r++++sg+ +ga++w atlqrqce+
  Potri.002G154700.1 507 SKVTWVEHAQYDERQIHQLYRPVISSGMGFGAQRWIATLQRQCEC 551
                         *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-20100174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21104174IPR009057Homeodomain-like
PROSITE profilePS5007117.216114174IPR001356Homeobox domain
SMARTSM003891.7E-17115178IPR001356Homeobox domain
CDDcd000862.03E-18116174No hitNo description
PfamPF000462.2E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084843.275317554IPR002913START domain
SuperFamilySSF559613.3E-32319551No hitNo description
CDDcd088759.57E-122321550No hitNo description
PfamPF018524.3E-53326551IPR002913START domain
SMARTSM002346.5E-44326551IPR002913START domain
SuperFamilySSF559611.65E-22579813No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MSFGGFLENT SPGGGGARIV ADILYNNNNN MPTGAIAQTR LVSPSITKSM FNSPGLSLAL  60
QQPNIDGQGD ITRMAENFET SVGRRSREEE HESRSGSDNM DGASGDDQDA ADNPPRKKRY  120
HRHTPQQIQE LEALFKECPH PDEKQRLELS RRLCLETRQV KFWFQNRRTQ MKTQLERHEN  180
SLLRQDNDKL RAENMSIRDA MRNPSCSNCG GPAIIGDMSL EEQHLRIENA RLKDELDRVC  240
ALAGKFLGRP ISSLASSLSP PTNSSLELAV GSNGFAGLST IATTLPLGPH FEGGISGALS  300
MVTQTRLATA GVTGIDRSVE RSMFLELALA AMDELVKMVQ TDEPLWIGSF EGGREILNHE  360
GYLRTFTPCI GMKPSGFVSE ASRETGMVII NSLALVETLM DSNRWAEMFP CMIARTSTTD  420
VIASGMGGTR NGSLQLMQAE LHVLSPLVPV REVNFLRFCK QHAEGVWAVV DVSIDTIRDT  480
SGAPPTFVNC RRLPSGCVVQ DMPNGYSKVT WVEHAQYDER QIHQLYRPVI SSGMGFGAQR  540
WIATLQRQCE CLAILLSSNV PSRDHTAITT SGRRSMLKLA QRMTDNFCAG VCASTVHKWN  600
KLNAGNVDED VRVMTRKSVD DPGEPPGIVL SAATSVWLPV SPQRLFDFLR NERLRSEWDI  660
LSNGGPMQEM AHIAKGQDHG NCVSLLRASA MNANQSSMLI LQETCIDAAG SLVVYAPVDT  720
PAMHVVMNGG DSAYVALLPS GFAIVPDGPG SRDPPSTNGG PTANNVGGQE RVSGSLLTVA  780
FQILVNSLPT AKLTVESVET VNNLISCTVQ KIKAALQCES *
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G154700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301331.20.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A385JHT90.0A0A385JHT9_POPTO; Homeodomain protein
TrEMBLB9GPV90.0B9GPV9_POPTR; Uncharacterized protein
STRINGPOPTR_0002s15610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]