PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G152900.2
Common NamePOPTR_0002s15430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 458aa    MW: 51170.6 Da    PI: 6.4106
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G152900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like73.14.1e-23209262155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kp l+Wt+eLH+rF++a++ L G + A Pk+il++m+v gL  e+v SHLQkYRl
  Potri.002G152900.2 209 KPELVWTNELHNRFLQAIRIL-GVDGAHPKKILQHMNVSGLKKENVSSHLQKYRL 262
                         6889*****************.********************************8 PP

2Response_reg61.44.8e-21251321107
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+v+ +p+ ++++ ++l+  gy ev++a+ +++al++l+ek+  ++lil+   +p+md +e++++ r+ +++lpi+v++a ++ + +l  
  Potri.002G152900.2  25 ILVVESDPTCLRIVSKMLQAFGY-EVTTATRATDALHILREKEdeINLILIETHLPDMDQYEIIETVRAMSSSLPIVVFSADNNVSAMLGW 114
                         89*********************.***************888778********************************************** PP

                         HHTTESEEEESS--HHHH CS
        Response_reg  90 lkaGakdflsKpfdpeel 107
                         l  Ga  +l+Kp+ ++++
  Potri.002G152900.2 115 LYKGAALYLMKPIVKNDV 132
                         ************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.2E-2721147No hitNo description
SuperFamilySSF521728.54E-2521142IPR011006CheY-like superfamily
SMARTSM004481.4E-1523136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011031.45224140IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.6E-1625133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.60E-1826127No hitNo description
SuperFamilySSF466892.51E-17207266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-24208266IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-21209262IPR006447Myb domain, plants
PfamPF002491.3E-6213261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MTSEQFLSVE VTKNNASSFA KGVRILVVES DPTCLRIVSK MLQAFGYEVT TATRATDALH  60
ILREKEDEIN LILIETHLPD MDQYEIIETV RAMSSSLPIV VFSADNNVSA MLGWLYKGAA  120
LYLMKPIVKN DVKNLWQLTY RKKKKTAVSS VGSNSFHAGL AEENASSVTA GIPSLLSTTG  180
QSDQMGKRKE LEETDNDDED NDNLTVLKKP ELVWTNELHN RFLQAIRILG VDGAHPKKIL  240
QHMNVSGLKK ENVSSHLQKY RLSLKREQDT TQKTMIRDHH PSLTLNLQGG FSQFTNPQFF  300
MAISQSEHRN NIQNNLCSPV SMHSLFSAHS LTRVNTNYDG MLIPSYGQQS KQLDRTYPNC  360
SHTGIGTTND GNFASLGQKG NHNVEEHLNQ GTTFSNVGTH GPTFLGNSQQ QLQFPLLQPQ  420
PLPEKEDESD IPNIVTEARN ELLVMKNEFL DYPNNDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-17205266162ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G152900.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1834260.0AC183426.2 Populus trichocarpa clone Pop1-45L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301318.30.0two-component response regulator ARR14 isoform X2
RefseqXP_024450142.10.0two-component response regulator ARR14 isoform X2
TrEMBLA0A2K2BJ700.0A0A2K2BJ70_POPTR; Uncharacterized protein
STRINGPOPTR_0002s15430.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.19e-51response regulator 2