PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G136400.5
Common NamePOPTR_0002s13720g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 229aa    MW: 25275.5 Da    PI: 8.0542
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G136400.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-1863117256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq  +Lee F+++++++ +e+  LAk+l+L  rqV vWFqNrRa+ k
  Potri.002G136400.5  63 RKKLRLSKEQSSVLEENFKEHNTLNPKEKLALAKQLNLRPRQVEVWFQNRRARTK 117
                         788899***********************************************98 PP

2HD-ZIP_I/II125.72.1e-4063152191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL kev+eLr +l
  Potri.002G136400.5  63 RKKLRLSKEQSSVLEENFKEHNTLNPKEKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKTCCENLTEENRRLLKEVQELR-AL 152
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-11136IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466894.71E-1952120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-1857122IPR009057Homeodomain-like
PROSITE profilePS5007117.55659119IPR001356Homeobox domain
SMARTSM003891.5E-1561123IPR001356Homeobox domain
PfamPF000466.5E-1663117IPR001356Homeobox domain
CDDcd000869.49E-1663120No hitNo description
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
SMARTSM003402.2E-24119162IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-10119153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MNRVPAAVAD CDDETGVSSP NSTLSSLISG KRSEREQIGE ETEAERASCS RGSDDEDGGD  60
ASRKKLRLSK EQSSVLEENF KEHNTLNPKE KLALAKQLNL RPRQVEVWFQ NRRARTKLKQ  120
TEVDCEYLKT CCENLTEENR RLLKEVQELR ALKLSPQLYM HMNPPTTLTM CPSCKRVVSS  180
ASSSSAAVVS SALAPIASTP QPQRPVPINP WAAMPIHHRT FDAPASSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16167SRKKLRL
2111119RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G136400.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450828.11e-166homeobox-leucine zipper protein HAT3 isoform X2
SwissprotP466021e-92HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLB9GP511e-165B9GP51_POPTR; Uncharacterized protein
STRINGPOPTR_0002s13720.11e-166(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-85homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]