PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G130200.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 253aa    MW: 27948.3 Da    PI: 10.1898
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G130200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-3247100255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.002G130200.2  47 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 100
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.36E-1544101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2844101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2347100IPR006447Myb domain, plants
PfamPF002491.4E-74899IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MADLSSPSFQ LPRNLNHLHH HNPQIYGGDF KRSARMISGV RRSKRAPRMR WTTTLHAHFV  60
HAVQLLGGHE RATPKSVLEL MNVKDLTLAH VKSHLQMYRT VKSTDKGSGQ GQTDMGLNQR  120
ARILEVDAAG LSSGKADASN PSQSLNNPSP PSPLPSVQKN QRNPRSLSMA GDEKNRSSLD  180
SLTYSSDFNA HDQSKEDGQK ATLHMAANMK ERLDSSSLSS SDMLLNLEFT LGRPSWHLNY  240
DESSNELTLL KC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-1748102357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1748102357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1748102357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1748102357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During ovule development, first expressed in the inner integument primordium and then on the abaxial side of the inner integument. {ECO:0000269|PubMed:16623911}.
UniprotTISSUE SPECIFICITY: Expressed in the periphery of the primary root apex and lateral root. {ECO:0000269|PubMed:15286295}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G130200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719890.0KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
GenBankKP2719900.0KP271990.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-293 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301209.30.0probable transcription factor KAN4 isoform X3
RefseqXP_024450888.10.0probable transcription factor KAN4 isoform X1
SwissprotQ9FJV54e-62KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A2K2BI440.0A0A2K2BI44_POPTR; Uncharacterized protein
STRINGXP_002510296.11e-109(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.18e-59G2-like family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]