PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G130200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 342aa    MW: 37341.8 Da    PI: 9.5454
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G130200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.8e-32136189255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.002G130200.1 136 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 189
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15133190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28133190IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23136189IPR006447Myb domain, plants
PfamPF002492.2E-7137188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MPLSSKHMMR AASPFPYLSL QISPPAVLEA KETGDDGGLA RKALCKDRSS ATDSGSSGSD  60
LSHENGLFNQ DRIAYNLGPS QPTLSLGFDM ADLSSPSFQL PRNLNHLHHH NPQIYGGDFK  120
RSARMISGVR RSKRAPRMRW TTTLHAHFVH AVQLLGGHER ATPKSVLELM NVKDLTLAHV  180
KSHLQMYRTV KSTDKGSGQG QTDMGLNQRA RILEVDAAGL SSGKADASNP SQSLNNPSPP  240
SPLPSVQKNQ RNPRSLSMAG DEKNRSSLDS LTYSSDFNAH DQSKEDGQKA TLHMAANMKE  300
RLDSSSLSSS DMLLNLEFTL GRPSWHLNYD ESSNELTLLK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-17137191357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17137191357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17137191357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17137191357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-17137191458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G130200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719890.0KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
GenBankKP2719900.0KP271990.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-293 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450888.10.0probable transcription factor KAN4 isoform X1
TrEMBLA0A2K2BI440.0A0A2K2BI44_POPTR; Uncharacterized protein
STRINGPOPTR_0002s13170.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.13e-63G2-like family protein