PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G129600.1
Common NamePOPTR_0002s13100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 307aa    MW: 32229.5 Da    PI: 5.6401
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G129600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.41.2e-362786362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++ l+cprC+st tkfCy+nny+lsqPryfCk+CrryWtkGG+lr+vPvGgg+rkn k+s
  Potri.002G129600.1 27 TEPLPCPRCNSTITKFCYFNNYNLSQPRYFCKSCRRYWTKGGTLRDVPVGGGSRKNSKRS 86
                        67899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-312984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5843084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-193478IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MPSEISQTHP NEAQNTMGTA PPPPKTTEPL PCPRCNSTIT KFCYFNNYNL SQPRYFCKSC  60
RRYWTKGGTL RDVPVGGGSR KNSKRSRSSS NNSSPSTSSS NSTASNPATL TAFTAIHEPE  120
SIPVVVSSTT DSGAAAVKTE MPAGINLNEG LAENGNFISL ISSNDQHGFN GLGGYGYGSG  180
FGLGPCEVGL GFGARGFWSF PGMENVSVNG GTIGGCTSGC NTWQLQGDHV EGGGSQGGFA  240
ADGENYFGSW PGLVISAPAE KEVSDHNALK LSFGFEECPG SGFVSSFEKL VNQFIQETPN  300
WNLFPV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.100910.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G129600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1469420.0EF146942.1 Populus trichocarpa clone WS01225_E04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386513.10.0dof zinc finger protein DOF1.6
TrEMBLA0A3N7FIV30.0A0A3N7FIV3_POPTR; Uncharacterized protein
STRINGPOPTR_0002s13100.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.15e-27Dof family protein