PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G086100.1
Common NamePOPTR_0002s08660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 508aa    MW: 56211.3 Da    PI: 6.1419
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G086100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3304.4e-1011125001374
                GRAS   1 lvelLlecAeavss..gdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykal.ppsetsekn.............. 73 
                         lv+lL+++Aea++   ++  la+ +L rl+el+sp++ ++m+Rlaayft AL+  l +++   +++  +++++                  
  Potri.002G086100.1 112 LVHLLIAAAEALTGlnKNSDLARVILVRLKELVSPNDgTNMERLAAYFTDALQGLLEGTGGIHSNKHhSVTNN---Gpyhhhhrddpqqhr 199
                         68**********98546777************8887669****************998332222222122221...112244555677788 PP

                GRAS  74 .sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesg..skeele 159
                          + ++laa++l++++sP++kf+h+taNqaIleav++++r+Hi+D+di++G+QW++L+qaL sR++gpp  +l+iT++++  s+  s  +++
  Potri.002G086100.1 200 hQNDALAAFQLLQDMSPYVKFGHFTANQAILEAVAEDRRIHIVDYDIMEGIQWASLMQALVSRKDGPPtpHLKITAMSRGGSSrrSIGTVQ 290
                         899999999*******************************************************776556********9777678999*** PP

                GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.n 249
                         etg+rL  fA+++g pf+f+    ++ e++++++L++ +gEal+ n++l+l ++  +  ++     ++L+  k+l+P+++++ve+e+   +
  Potri.002G086100.1 291 ETGRRLVAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEALVMNCMLHLPHFSYRAPDSV---ASFLSGAKTLNPRLITMVEEEVGPiG 378
                         *********************9999****************************985555555...59*******************9988* PP

                GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                         ++ F+ rf+++l++ysa++ds+ea++p + ++r+ vEr++lg++i+  +a   ++   r e++  W e+l + GF+pv++s  +++qakll
  Potri.002G086100.1 379 DGGFVGRFMDSLHHYSAFYDSMEAGFPMQGRARALVERVILGPRISGSLARIYRA---RGEEVCPWWEWLAARGFQPVKVSFANNCQAKLL 466
                         ******************************************************9...888889*************************** PP

                GRAS 341 lrkvksdgyrveee.sgslvlgWkdrpLvsvSaWr 374
                         l  ++ dgyrvee  s+ lvlgWk+r+L+s+S W+
  Potri.002G086100.1 467 LGVFN-DGYRVEELaSNRLVLGWKSRRLLSASIWT 500
                         *****.******876999****************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.97686480IPR005202Transcription factor GRAS
PfamPF035141.5E-98112500IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MAMAIDGTKF ELDFSGYSST TTTATTTPTI STENDHDHAC NWNDWSPMVD WEALSGPHDD  60
FQDLIDSMMD DGALMNQSSR LTPDTSNSMS TSDTVFVDEE TSCSNDFKGL RLVHLLIAAA  120
EALTGLNKNS DLARVILVRL KELVSPNDGT NMERLAAYFT DALQGLLEGT GGIHSNKHHS  180
VTNNGPYHHH HRDDPQQHRH QNDALAAFQL LQDMSPYVKF GHFTANQAIL EAVAEDRRIH  240
IVDYDIMEGI QWASLMQALV SRKDGPPTPH LKITAMSRGG SSRRSIGTVQ ETGRRLVAFA  300
ASIGQPFSFH QCRLDSDETF RPSALKLVKG EALVMNCMLH LPHFSYRAPD SVASFLSGAK  360
TLNPRLITMV EEEVGPIGDG GFVGRFMDSL HHYSAFYDSM EAGFPMQGRA RALVERVILG  420
PRISGSLARI YRARGEEVCP WWEWLAARGF QPVKVSFANN CQAKLLLGVF NDGYRVEELA  480
SNRLVLGWKS RRLLSASIWT SPSDPDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4414949937374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302249.10.0scarecrow transcription factor family protein
SwissprotQ5NE240.0NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLB9GUD30.0B9GUD3_POPTR; Scarecrow transcription factor family protein
STRINGPOPTR_0002s08660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP68391319
FabidsOGEF62643152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-163GRAS family protein