PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G073400.2
Common NamePOPTR_0002s07430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 586aa    MW: 65523 Da    PI: 4.8049
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G073400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.21.1e-1362165852374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL+ecA+a+s+g+ e+a++l+++l++l+s +gdp qR+aay++e+Laar+a+s++ lykal+++e +   ss++laa+++++e++P++k
  Potri.002G073400.2 216 RRLLFECANAISEGNIEKASTLINELRQLVSIQGDPPQRIAAYMVEGLAARMAESGKYLYKALKCKEPP---SSDRLAAMQILFEICPCFK 303
                         689*****************************************************************9...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         f++++aN a+ ea++ge+rvHiiDfdi+qG Q+++L+q+La+ +++ p+lR+Tgv++pes+      l+ +g+rL+k+Ae+ +v+fef++ 
  Potri.002G073400.2 304 FGFMAANGAMIEAFKGERRVHIIDFDINQGSQYITLIQTLANHQGKLPHLRLTGVDDPESVqrPVGGLRIIGQRLEKLAEAYKVSFEFHA- 393
                         ***********************************************************99888899***********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         va++++ +++++L++kpgEal+Vn+++qlh+++desvs+ +erd++L++ ksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+fdsl+
  Potri.002G073400.2 394 VASKTSLVNPSMLNCKPGEALIVNFAFQLHHMPDESVSTVNERDQLLRMAKSLNPKLVTVVEQDVNTNTAPFFPRFTEAYNYYSAVFDSLD 484
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpres++r +vE+++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ +++ ++++ ++ l++++ ++ y++++e g+l +gW+
  Potri.002G073400.2 485 ATLPRESQDRLNVEKQCLARDIVNIVACEGEERIERYEVAGKWRARMMMAGFTSCSITPNVVDMIRKLIKEYCDR-YMLKQEVGALHFGWE 574
                         *************************************************************************66.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         d++L+++SaW+
  Potri.002G073400.2 575 DKSLIVASAWK 585
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.035189566IPR005202Transcription factor GRAS
PfamPF035143.8E-134216585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MSLVGPAELS ATPYGNHKLY SLKGSNDNSG LSAQIFCPDK RQNMYMTDSY SSESYEKYFL  60
DSPTEELIQP SSSGISGNSA PPQGTSSYQL RKNLGSSMSP QDDPYDACFT LTTPCDGYQF  120
NSESDYLDIE SPDPLNYDEY KMKLKFQELE RALLNDNDED GMFGNSQSME MDGEWSDPIQ  180
NGMLHDSPKE SSSSDSSLSS ISSNKEVSQL SPRTPRRLLF ECANAISEGN IEKASTLINE  240
LRQLVSIQGD PPQRIAAYMV EGLAARMAES GKYLYKALKC KEPPSSDRLA AMQILFEICP  300
CFKFGFMAAN GAMIEAFKGE RRVHIIDFDI NQGSQYITLI QTLANHQGKL PHLRLTGVDD  360
PESVQRPVGG LRIIGQRLEK LAEAYKVSFE FHAVASKTSL VNPSMLNCKP GEALIVNFAF  420
QLHHMPDESV STVNERDQLL RMAKSLNPKL VTVVEQDVNT NTAPFFPRFT EAYNYYSAVF  480
DSLDATLPRE SQDRLNVEKQ CLARDIVNIV ACEGEERIER YEVAGKWRAR MMMAGFTSCS  540
ITPNVVDMIR KLIKEYCDRY MLKQEVGALH FGWEDKSLIV ASAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-502195858375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164550.0AC216455.1 Populus trichocarpa clone POP032-C02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302201.10.0SCARECROW-LIKE 1 family protein
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLB9GTP10.0B9GTP1_POPTR; SCARECROW-LIKE 1 family protein
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1