PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G070700.2
Common NamePOPTR_0002s07150g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 294aa    MW: 33322.9 Da    PI: 4.3627
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G070700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.52e-353186661
              zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +cprC s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvP Ggg+rk +++
  Potri.002G070700.2 31 PNCPRCASPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPAGGGCRKYRRN 86
                        58**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-281985IPR003851Zinc finger, Dof-type
PfamPF027012.4E-303185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.8383185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MYSASDQMMF QCPPRPFPME RKWKSNIEVA PNCPRCASPN TKFCYYNNYS LSQPRYFCKG  60
CRRYWTKGGS LRNVPAGGGC RKYRRNERAA VSLDYSRANE TLACSSNKDS VAQQDGANGS  120
DIDLAAVFSK FLNQDLSYGP EFIGEELRDE GSELVNISNS STPISDSYQN DPMMESLKRS  180
DLTQESNLLE GRSQVLVGEK QQFEEDQRFQ ELIESQDMNA FGLQNLLIDE IVQDALWSDD  240
ATLPHVPNWQ PMVQLQDFDS FSVDDRLKIS ANFTSDDNWS SFDLSGFEVF PRP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174179ESLKRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.122500.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G070700.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2227461e-137CU222746.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024451995.10.0dof zinc finger protein DOF1.2
TrEMBLA0A2K2BES30.0A0A2K2BES3_POPTR; Uncharacterized protein
STRINGPOPTR_0002s07150.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-44Dof family protein